- Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant FCGR2A.
Immunogen
FCGR2A (AAH20823, 46 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (62)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.29 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FCGR2A is approximately 0.03ng/ml as a capture antibody.ELISA
- Gene Info — FCGR2A
Entrez GeneID
2212GeneBank Accession#
BC020823Protein Accession#
AAH20823Gene Name
FCGR2A
Gene Alias
CD32, CD32A, CDw32, FCG2, FCGR2, FCGR2A1, FcGR, IGFR2, MGC23887, MGC30032
Gene Description
Fc fragment of IgG, low affinity IIa, receptor (CD32)
Omim ID
146790Gene Ontology
HyperlinkGene Summary
This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
Fc fragment of IgG, low affinity IIa, receptor|Fc fragment of IgG, low affinity IIa, receptor for (CD32)|Immunoglobulin G Fc receptor II|OTTHUMP00000032377
- Interactomes
- Pathways
- Diseases
FCGR2A monoclonal antibody (M06), clone 3E8
Cat# H00002212-M06
Size : 100ug
Brand : Abnova
Images