CD73, Recombinant, Human, aa27-547, His-Tag (5'-Nucleotidase, Ecto-5'-Nucleotidase)

Cat# 298395-50ug

Size : 50ug

Brand : US Biological



298395 CD73, Recombinant, Human, aa27-547, His-Tag (5'-Nucleotidase, Ecto-5'-Nucleotidase)

Clone Type
Polyclonal
Swiss Prot
P21589
Grade
Highly Purified
Accession #
NM_002526
Shipping Temp
Dry Ice
Storage Temp
-70°C

The protein encoded by this gene is a plasma membrane protein that catalyzes the conversion of extracellular nucleotides to membrane-permeable nucleosides. The encoded protein is used as a determinant of lymphocyte differentiation. Defects in this gene can lead to the calcification of joints and arteries. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011].||Source:|Recombinant protein corresponding to aa27-547 from human CD73, fused to His-tag at C-terminal, expressed in HEK293 cell expression system.||Molecular Weight: |~58.6kD, protein runs at a higher MW by SDS-PAGE due to glycosylation||AA Sequence:|WELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDA|GDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPIL|SANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITAL|QPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHSNTFLYTGNPPSKEV|PAGKYPFIVTSDDGRKVPVVQAYAFGKYLGYLKIEFDERGNVISSHGNPILLNSSIPED|PSIKADINKWRIKLDNYSTQELGKTIVYLDGSSQSCRFRECNMGNLICDAMINNNLRHT|DEMFWNHVSMCILNGGGIRSPIDERNNGTITWENLAAVLPFGGTFDLVQLKGSTLKKA|FEHSVHRYGQSTGEFLQVGGIHVVYDLSRKPGDRVVKLDVLCTKCRVPSYDPLKMDE|VYKVILPNFLANGGDGFQMIKDELLRHDSGDQDINVVSTYISKMKVIYPAVEGRIKHHH|HHH||Applications: |Suitable for use in studying enzyme kinetics, substrate specificity, and screening inhibitors. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||Storage and Stability:|Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Applications
Source: Recombinant, HEK293 cells|Purity: Highly Purified (~90%)|Concentration: ~0.5mg/ml|Form: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 20% glycerol.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 20% glycerol.
Purity
Highly Purified (~90%)
References
1. Deaglio, S. et al., J. Exp. Med. 2007; 204(6): 1257-1265. 2. Thompson, L.F., et al., J. Exp. Med. 2004; 200(11): 1395-1405.