Reagents and instruments for immunology, cell biology and molecular biology.
 
> B-type Natriuretic Peptide Human Recombinant ( BNP Human )

B-type Natriuretic Peptide Human Recombinant ( BNP Human )

Print Print
Please log in

Cat# PT_41632-25mg

Size : 25mg

Brand : Novatein Biosciences


B-type Natriuretic Peptide Human Recombinant ( BNP Human )

DescriptionB-type Natriuretic Peptide Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. NPPB is purified by proprietary chromatographic

Data sheet

Formulation Natriuretic Peptide Precursor B was lyophilized from 0.4ml PBS buffer containing 20mM phosphate buffer and 0.6mM sodium chloride.
Solubility It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18M-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Purity Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Description B-type Natriuretic Peptide Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. NPPB is purified by proprietary chromatographic techniques.
Protein Background Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.
Expression host Escherichia Coli.
Synonyms NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide.
Reagent Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Stability Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution NPPB should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Amino acid sequence SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.