UPK3BL1 Rabbit Polyclonal Antibody
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-UPK3BL antibody is: synthetic peptide directed towards the C-terminal region of Human UPK3BL. Synthetic peptide located within the following region: PTKIGCNHPLPGPGPYRVKFLVMNDEGPVAETKWSSDTRLQQAQALRAVP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 28 kDa |
Gene Name | uroplakin 3B-like |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | UPLP |
Note | Human: 100%; Pig: 83%; Horse: 83% |
Reference Data |
Documents
Product Manuals |
FAQs |
|
SDS |
Resources
Antibody Resources |
|