TRA16 (NR2C2AP) Rabbit Polyclonal Antibody

CAT#: TA337564

Rabbit Polyclonal Anti-NR2C2AP Antibody


Product Images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NR2C2AP antibody: synthetic peptide directed towards the N terminal of human NR2C2AP. Synthetic peptide located within the following region: THSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 16 kDa
Gene Name nuclear receptor 2C2 associated protein
Background NR2C2AP may act as a repressor of NR2C2-mediated transactivation by suppressing the binding between NR2C2/TR4 and the TR4-response element in target genes.
Synonyms TRA16
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Guinea pig: 93%
Reference Data
Protein Families Druggable Genome

Documents