TBX3 (T-box 3, T-box Family of Transcription Factors, T-box Protein 3) (HRP)
Cat# 134266-HRP-100ul
Size : 100ul
Brand : US Biological
134266-HRP Rabbit Anti-TBX3 (T-box 3, T-box Family of Transcription Factors, T-box Protein 3) (HRP)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgG1,kGrade
Affinity PurifiedApplications
E WBCrossreactivity
HuAccession #
NM_005996, NP_005987Shipping Temp
Blue IceStorage Temp
-20°CThis gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This protein is a transcriptional repressor and is thought to play a role in the anterior/posterior axis of the tetrapod forelimb. Mutations in this gene cause ulnar-mammary syndrome, affecting limb, apocrine gland, tooth, hair, and genital development. Alternative splicing of this gene results in three transcript variants encoding different isoforms; however, the full length nature of one variant has not been determined. [provided by RefSeq]||Applications:|Suitable for use in ELISA and Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|KENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAERPRDSGRLDK||Storage and Stability:|Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.||Note: Applications are based on unconjugated antibody.