- More Files
- Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant TARDBP.
Immunogen
TARDBP (NP_031401.1, 1 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (54.34 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Cell lysate)
TARDBP monoclonal antibody (M01), clone 2E2-D3 Western Blot analysis of TARDBP expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of TARDBP expression in transfected 293T cell line by TARDBP monoclonal antibody (M01), clone 2E2-D3.
Lane 1: TARDBP transfected lysate(44.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TARDBP on formalin-fixed paraffin-embedded human leiomyosarcoma tissue [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of TARDBP transfected lysate using anti-TARDBP monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TARDBP MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TARDBP is 0.3 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of TARDBP over-expressed 293 cell line, cotransfected with TARDBP Validated Chimera RNAi ( Cat # H00023435-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TARDBP monoclonal antibody (M01), clone 2E2-D3 (Cat # H00023435-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to TARDBP on HeLa cell. [antibody concentration 10 ug/ml] - Gene Info — TARDBP
Entrez GeneID
23435GeneBank Accession#
NM_007375.3Protein Accession#
NP_031401.1Gene Name
TARDBP
Gene Alias
ALS10, TDP-43
Gene Description
TAR DNA binding protein
Omim ID
605078Gene Ontology
HyperlinkGene Summary
HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20. [provided by RefSeq
Other Designations
OTTHUMP00000002171|TAR DNA-binding protein-43
- Interactomes
- Diseases
- Publication Reference
- Rebalancing the motor circuit restores movement in a Caenorhabditis elegans model for TDP-43 toxicity.
Mandy Koopman., Lale Güngördü., Leen Janssen., Renée I Seinstra., Janet E Richmond., Nathan Okerlund., René Wardenaar., Priota Islam., Wytse Hogewerf., Andre E X Brown., Erik M Jorgensen., Ellen A A Nollen.
Cell Reports 2024 May; 43(5):114204.
Application:Behavioral profiling and neuronal analysis, Caenorhabditis elegans, Whole worms.
- Argyrophilic grain disease and co-pathologies in an older patient with a rapidly progressive neuropsychiatric syndrome.
Camilla N Clark, Norman Poole, Jeremy D Isaacs, Andrew D MacKinnon, Philip Rich, Leslie R Bridges, Zane Jaunmuktane, Elizabeth Caruana Galizia.
Neuropathology and Applied Neurobiology 2024 Apr; 50(2):e12973.
Application:IHC-P, Human, Brain.
- Platinum-based drugs induce phenotypic alterations in nucleoli and Cajal bodies in prostate cancer cells.
Enkhzaya Batnasan, Minttu Kärkkäinen, Sonja Koivukoski, Nithin Sadeesh, Sylvain Tollis, Pekka Ruusuvuori, Mauro Scaravilli, Leena Latonen.
Cancer Cell International 2024 Jan; 24(1):29.
Application:IF, Human, LNCaP, 22Rv1, PC-3 cell lines.
- Mitigating a TDP-43 proteinopathy by targeting ataxin-2 using RNA-targeting CRISPR effector proteins.
M Alejandra Zeballos C, Hayden J Moore, Tyler J Smith, Jackson E Powell, Najah S Ahsan, Sijia Zhang, Thomas Gaj.
Nature Communications 2023 Oct; 14(1):6492.
Application:SG assays, Human, HEK293T cells.
- FUS RRM regulates poly(ADP-ribose) levels after transcriptional arrest and PARP-1 activation on DNA damage.
Evgeniya M Mamontova, Marie-Jeanne Clément, Maria V Sukhanova, Vandana Joshi, Ahmed Bouhss, Juan Carlos Rengifo-Gonzalez, Bénédicte Desforges, Loic Hamon, Olga I Lavrik, David Pastré.
Cell Reports 2023 Oct; 42(10):113199.
Application:IF, Human, HeLa cells.
- Neuromuscular junction denervation and terminal Schwann cell loss in the hTDP-43 overexpression mouse model of amyotrophic lateral sclerosis.
Abrar Alhindi, Megan Shand, Hannah L Smith, Ana S Leite, Yu-Ting Huang, Dinja van der Hoorn, Zara Ridgway, Kiterie M E Faller, Ross A Jones, Thomas H Gillingwater, Helena Chaytow.
Neuropathology and Applied Neurobiology 2023 Aug; 49(4):e12925.
Application:WB-Ti, Mouse, Brain, spinal cord.
- Late Presentation of Chronic Traumatic Encephalopathy in a Former Association Football Player.
Patrick W Cullinane., Sarah Wrigley., Teisha Y Bradshaw., Karen Shaw., Samuel Shribman., Eduardo de Pablo Fernandez., Thomas T Warner., Zane Jaunmuktane.
Movement Disorders Clinical Practice 2023 Jul; 10(9):1414.
Application:IHC, Human, Brain tissue (Post-mortem).
- Hyperglycemia and O-GlcNAc transferase activity drive a cancer stem cell pathway in triple-negative breast cancer.
Saheed A Ayodeji, Bin Bao, Emily A Teslow, Lisa A Polin, Greg Dyson, Aliccia Bollig-Fischer, Charlie Fehl.
Cancer Cell International 2023 May; 23(1):102.
Application:WB-Ce, Human, HCC70, MDA-MB231, MDA-MB468 cells.
- Neuronal overexpression of hTDP-43 in Caenorhabditis elegans mimics the cellular pathology commonly observed in TDP-43 proteinopathies.
Mandy Koopman, Lale Güngördü, Renée I Seinstra, Wytse Hogewerf, Ellen A A Nollen.
MicroPublication Biology 2023 Apr; 2023:10.17912/m.
Application:WB, Nematoda, Worms.
- Sustained therapeutic benefits by transient reduction of TDP-43 using ENA-modified antisense oligonucleotides in ALS/FTD mice.
Toshihide Takeuchi, Kazuhiro Maeta, Xin Ding, Yukako Oe, Akiko Takeda, Mana Inoue, Seiichi Nagano, Tsuyoshi Fujihara, Seiji Matsuda, Shinsuke Ishigaki, Kentaro Sahashi, Eiko N Minakawa, Hideki Mochizuki, Masahiro Neya, Gen Sobue, Yoshitaka Nagai.
Molecular Therapy. Nucleic Acids 2023 Mar; 31:353.
Application:WB-Ce, WB-Ti, Human, Mouse, HEK293 cells, Mouse brain cortex, Mouse hippocampus, Mouse spinal cord.
- Sporadic Creutzfeldt-Jakob disease VM1: phenotypic and molecular characterization of a novel subtype of human prion disease.
Ellen Gelpi, Simone Baiardi, Carlos Nos, Sofia Dellavalle, Iban Aldecoa, Raquel Ruiz-Garcia, Lourdes Ispierto, Domingo Escudero, Virgina Casado, Elena Barranco, Anuncia Boltes, Laura Molina-Porcel, Nuria Bargalló, Marcello Rossi, Angela Mammana, Dorina Tiple, Luana Vaianella, Elisabeth Stoegmann, Ingrid Simonitsch-Klupp, Gregor Kasprian, Sigrid Klotz, Romana Höftberger, Herbert Budka, Gabor G Kovacs, Isidre Ferrer, Sabina Capellari, Raquel Sanchez-Valle, Piero Parchi.
Acta Neuropathologica Communications 2022 Aug; 10(1):114.
Application:IHC-P, Human, Human brain.
- Atypical TDP-43 protein expression in an ALS pedigree carrying a p.Y374X truncation mutation in TARDBP
Johnathan Cooper-Knock, Thomas H Julian, Emily Feneberg, J Robin Highley, Maurice Sidra, Martin R Turner, Kevin Talbot, Olaf Ansorge, Scott P Allen, Tobias Moll, Tatyana Shelkovnikova, Lydia Castelli, Guillaume M Hautbergue, Christopher Hewitt, Janine Kirby, Stephen B Wharton, Richard J Mead, Pamela J Shaw.
Brain pathology (Zurich, Switzerland) 2022 Jul; e13104:0.
Application:WB, Human, Fibroblast, Motor cortex tissue.
- Modulation of synaptic plasticity, motor unit physiology, and TDP-43 pathology by CHCHD10.
Tian Liu, Jung-A A Woo, Mohammed Zaheen Bukhari, Xinming Wang, Yan Yan, Sara Cazzaro Buosi, Aizara Ermekbaeva, Apoorva Sista, Peter Kotsiviras, Patrick LePochat, Ann Chacko, Xingyu Zhao, David E Kang.
Acta Neuropathologica Communications 2022 Jul; 10(1):95.
Application:WB-Ce, Human, Human cortex brain.
- Sirtuin-1 sensitive lysine-136 acetylation drives phase separation and pathological aggregation of TDP-43.
Jorge Garcia Morato, Friederike Hans, Felix von Zweydorf, Regina Feederle, Simon J Elsässer, Angelos A Skodras, Christian Johannes Gloeckner, Emanuele Buratti, Manuela Neumann, Philipp J Kahle.
Nature Communications 2022 Mar; 13(1):1223.
Application:IF, WB-Tr, Human, HEK293E cells.
- Neuropathological findings in possible normal pressure hydro-cephalus: A post-mortem study of 29 cases with lifelines.
Joni J Hänninen, Madoka Nakajima, Aleksi Vanninen, Santtu Hytönen, Jaana Rummukainen, Anne Maria Koivisto, Juha E Jääskeläinen, Hilkka Soininen, Anna Sutela, Ritva Vanninen, Mikko Hiltunen, Ville Leinonen, Tuomas Rauramaa.
Free Neuropathology 2022 Jan; 3:3.
Application:IHC-P, Human, Human brain.
- A Microplate-Based Approach to Map Interactions between TDP-43 and α-Synuclein.
Angelo M Jamerlan, Seong Soo A An.
Journal of Clinical Medicine 2022 Jan; 11(3):573.
Application:ELISA, Peptides.
- Homozygous R136S mutation in PRNP gene causes inherited early onset prion disease.
Teresa Ximelis, Alba Marín-Moreno, Juan Carlos Espinosa, Hasier Eraña, Jorge M Charco, Isabel Hernández, Carmen Riveira, Daniel Alcolea, Eva González-Roca, Iban Aldecoa, Laura Molina-Porcel, Piero Parchi, Marcello Rossi, Joaquín Castilla, Raquel Ruiz-García, Ellen Gelpi, Juan María Torres, Raquel Sánchez-Valle.
Alzheimer's Research & Therapy 2021 Oct; 13(1):176.
Application:IHC-P, Mouse, Mouse brain.
- A system-wide mislocalization of RNA-binding proteins in motor neurons is a new feature of ALS.
Yu-Ju Liu, Hung-Chih Kuo, Yijuang Chern.
Neurobiology of Disease 2021 Dec; 160:105531.
Application:WB-Ce, Mouse, NSC34 cells.
- Aptamer-based enrichment of TDP-43 from human cells and tissues with quantification by HPLC-MS/MS.
Taylor D Pobran, David Yang, Ian R A Mackenzie, Mari L DeMarco.
Journal of Neuroscience Methods 2021 Nov; 363:109344.
Application:WB-Ce, Human, HeLa cells.
- CSF Diagnostics: A Potentially Valuable Tool in Neurodegenerative and Inflammatory Disorders Involving Motor Neurons: A Review.
Karsten Krause, Maximilian Wulf, Paula Sommer, Katalin Barkovits, Matthias Vorgerd, Katrin Marcus, Britta Eggers.
Diagnostics (Basel, Switzerland) 2021 Aug; 11(9):1522.
Application:ELISA, WB, Human, Human cerebrospinal fluid.
- Novel tankyrase inhibitors suppress TDP-43 aggregate formation.
Kunikazu Tanji, Fumiaki Mori, Fumiyuki Shirai, Takehiro Fukami, Hiroyuki Seimiya, Jun Utsumi, Akiyoshi Kakita, Koichi Wakabayashi.
Biochemical and Biophysical Research Communications 2021 Jan; 537:85.
Application:IF, WB-Tr, Human, HEK 293, SH-SY5Y cells.
- Monoclonal full-length antibody against TAR DNA-binding protein 43 reduces related proteinopathy in neurons.
Silvia Pozzi, Philippe Codron, Genevieve Soucy, Laurence Renaud, Pierre Cordeau, Kallol Dutta, Christine Bareil, Jean-Pierre Julien.
JCI Insight 2020 Nov; 5(21):140420.
Application:ELISA, Dot, Human, Human recombinant protein.
- Withaferin-A Treatment Alleviates TAR DNA-Binding Protein-43 Pathology and Improves Cognitive Function in a Mouse Model of FTLD.
Sunny Kumar, Daniel Phaneuf, Jean-Pierre Julien.
Neurotherapeutics : the Journal of the American Society for Experimental NeuroTherapeutics 2021 Jan; 18(1):286.
Application:WB, Mouse, Brain.
- Hypusination of Eif5a regulates cytoplasmic TDP-43 aggregation and accumulation in a stress-induced cellular model.
Shayna Smeltzer, Zainuddin Quadri, Abraian Miller, Frank Zamudio, Jordan Hunter, Nicholas J F Stewart, Sheba Saji, Daniel C Lee, Dale Chaput, Maj-Linda B Selenica.
Biochimica et Biophysica Acta. Molecular Basis of Disease 2020 Aug; 165939.
Application:WB, Human, TDP-43 cell.
- Mitigation of ALS Pathology by Neuron-Specific Inhibition of Nuclear Factor Kappa B Signaling.
Kallol Dutta, Sai Sampath Thammisetty, Hejer Boutej, Christine Bareil, Jean-Pierre Julien.
Journal of Neuroscience 2020 Jun; 40(26):5137.
Application:IF, Mouse, Spinal cord neurons.
- Transmission of ALS pathogenesis by the cerebrospinal fluid.
Mishra PS, Boutej H, Soucy G, Bareil C, Kumar S, Picher-Martel V, Dupré N, Kriz J, Julien JP.
Acta Neuropathologica Communications 2020 May; 8(1):65.
Application:IF, WB-Ti, Mouse, Mouse brains.
- CHCHD10-regulated OPA1-mitofilin complex mediates TDP-43-induced mitochondrial phenotypes associated with frontotemporal dementia.
Tian Liu, Jung-A A Woo, Mohammed Zaheen Bukhari, Patrick LePochat, Ann Chacko, Maj-Linda B Selenica, Yan Yan, Peter Kotsiviras, Sara Cazzaro Buosi, Xingyu Zhao, David E Kang.
FASEB Journal 2020 Jun; 34(6):8493.
Application:WB-Ti, Mouse, Brain.
- BraInMap Elucidates the Macromolecular Connectivity Landscape of Mammalian Brain.
Reza Pourhaghighi, Peter E A Ash, Sadhna Phanse, Florian Goebels, Lucas Z M Hu, Siwei Chen, Yingying Zhang, Shayne D Wierbowski, Samantha Boudeau, Mohamed T Moutaoufik, Ramy H Malty, Edyta Malolepsza, Kalliopi Tsafou, Aparna Nathan, Graham Cromar, Hongbo Guo, Ali Al Abdullatif, Daniel J Apicco, Lindsay A Becker, Aaron D Gitler, Stefan M Pulst, Ahmed Youssef, Ryan Hekman, Pierre C Havugimana, Carl A White, Benjamin C Blum, Antonia Ratti, Camron D Bryant, John Parkinson, Kasper Lage, Mohan Babu, H
Cell Systems 2020 Apr; 10(4):333.
Application:IF, IP, Mouse, Mouse brains.
- Conserved Metabolite Regulation of Stress Granule Assembly via AdoMet.
Kyle Begovich, Anthony Q Vu, Gene Yeo, James E Wilhelm.
The Journal of Cell Biology 2020 Aug; 219(8):e201904141.
Application:IF, Human, iPSC-derived motor neurons.
- Activation of the Unfolded Protein Response and Proteostasis Disturbance in Parkinsonism-Dementia of Guam.
Verheijen BM, Lussier C, Müller-Hübers C, Garruto RM, Oyanagi K, Braun RJ, van Leeuwen FW.
Journal of Neuropathology and Eexperimental Neurology 2020 Jan; 79(1):34.
Application:IHC-P, Human, Human hippocampal sections.
- Mutant C9orf72 human iPSC-derived astrocytes cause non-cell autonomous motor neuron pathophysiology.
Zhao C, Devlin AC, Chouhan AK, Selvaraj BT, Stavrou M, Burr K, Brivio V, He X, Mehta AR, Story D, Shaw CE, Dando O, Hardingham GE, Miles GB, Chandran S.
Glia 2020 May; 68(5):1046.
Application:IF, Human, Human iPSC-derived astrocytes.
- Multiple distinct pathways lead to hyperubiquitylated insoluble TDP-43 protein independent of its translocation into stress granules.
Hans F, Glasebach H, Kahle PJ.
The Journal of Biological Chemistry 2020 Jan; 295(3):673.
Application:IF, Human, HEK 293E cells.
- Two pathologically confirmed cases of novel mutations in the MAPT gene causing frontotemporal dementia.
Shafei R, Woollacott IOC, Mummery CJ, Bocchetta M, Guerreiro R, Bras J, Warren JD, Lashley T, Jaunmuktane Z, Rohrer JD.
Neurobiology of Aging 2020 Mar; 87:141.
Application:IHC-P, Human, Human brains.
- Improved detection of prostate cancer using a magneto-nanosensor assay for serum circulating autoantibodies.
Xu L, Lee JR, Hao S, Ling XB, Brooks JD, Wang SX, Gambhir SS.
PLoS One 2019 Aug; 14(8):e0221051.
Application:Func, Det Ab, Human, Human serum.
- Amylin as a potential link between type 2 diabetes and alzheimer disease.
Martinez-Valbuena I, Valenti-Azcarate R, Amat-Villegas I, Riverol M, Marcilla I, de Andrea CE, Sánchez-Arias JA, Del Mar Carmona-Abellan M, Marti G, Erro E, Martínez-Vila E, Tuñon MT, Luquin MR.
Annals of Neurology 2019 Oct; 86(4):539.
Application:IHC-P, Human, Human brains.
- Detection and characterization of TDP-43 in human cells and tissues by multiple reaction monitoring mass spectrometry.
Taylor D Pobran, Lauren M Forgrave, Yu Zi Zheng, John G K Lim, Ian R A Mackenzie, Mari L DeMarco.
Clinical Mass Spectrometry (Del Mar, Calif.) 2019 Jul; 14:66.
Application:WB, Human, HeLa cells.
- Improving diagnostic accuracy of multiple system atrophy: a clinicopathological study.
Miki Y, Foti SC, Asi YT, Tsushima E, Quinn N, Ling H, Holton JL.
Brain 2019 Jul; awz189.
Application:IHC-P, Human, Human brains.
- MAPT p.V363I mutation: A rare cause of corticobasal degeneration.
Ahmed S, Fairen MD, Sabir MS, Pastor P, Ding J, Ispierto L, Butala A, Morris CM, Schulte C, Gasser T, Jabbari E, Pletnikova O, Morris HR, Troncoso J, Gelpi E, Pantelyat A, Scholz SW.
Neurology. Genetics 2019 Jun; 5(4):e347.
Application:IHC-P, Human, Human brains.
- Autophagy markers LC3 and p62 accumulate in immune-mediated necrotizing myopathy.
Francesco G, Anna L, Tiziana A, Margherita G, Angela A, Dario D, Marilina T, Daniela V, Domenico R, Luigi S, Florenzo I, Maria T.
Muscle & Nerve 2019 Sep; 60(3):315.
Application:IHC-Fr, Human, Human muscle biopsy specimens.
- Caspase-4 mediates cytoplasmic accumulation of TDP-43 in the primate brains.
Yin P, Guo X, Yang W, Yan S, Yang S, Zhao T, Sun Q, Liu Y, Li S, Li XJ.
Acta Neuropathologica 2019 Feb; [Epub].
Application:WB, Monkey, Mouse, Brains.
- Morphology and Distribution of TDP-43 Pre-inclusions in Primary Progressive Aphasia.
Kim G, Bolbolan K, Shahidehpour R, Jamshidi P, Gefen T, Ayala IA, Weintraub S, Bigio EH, Mesulam MM, Geula C.
Journal of Neuropathology and Eexperimental Neurology 2019 Mar; 78(3):229.
Application:IHC-P, Human, Brain.
- Impaired Nucleoporins Are Present in Sporadic Amyotrophic Lateral Sclerosis Motor Neurons that Exhibit Mislocalization of the 43-kDa TAR DNA-Binding Protein.
Aizawa H, Yamashita T, Kato H, Kimura T, Kwak S.
Journal of Clinical Neurology (Seoul, Korea) 2019 Jan; 15(1):62.
Application:IF, Human, Lumbar spinal-cord sections.
- Presence of tau astrogliopathy in frontotemporal dementia caused by a novel Grn nonsense (Trp2*) mutation.
Gómez-Tortosa E, Baradaran-Heravi Y, González Alvarez V, Sainz MJ, Prieto-Jurczynska C, Guerrero-López R, Agüero Rabes P, Van Broeckhoven C, van der Zee J, Rábano Gutiérrez A; EU EOD Consortium.
Neurobiology of Aging 2019 Apr; 76.
Application:IHC-P, Human, Human brains.
- Age-related deregulation of TDP-43 after stroke enhances NF-κB-mediated inflammation and neuronal damage.
Thammisetty SS, Pedragosa J, Weng YC, Calon F, Planas A, Kriz J.
Journal of Neuroinflammation 2018 Nov; 15(1):312.
Application:IHC-P, Human, Brain.
- Biomarkers for diseases with TDP-43 pathology.
Steinacker P, Barschke P, Otto M.
Molecular and Cellular Neurosciences 2019 Jun; 97:43.
- Variably protease-sensitive prionopathy presenting within ALS/FTD spectrum.
Vicente-Pascual M, Rossi M, Gámez J, Lladó A, Valls J, Grau-Rivera O, Ávila Polo R, Llorens F, Zerr I, Ferrer I, Nos C, Parchi P, Sánchez-Valle R, Gelpí E.
Annals of Clinical and Translational Neurology 2018 Sep; 5(10):1297.
Application:IHC, Human, Human brains.
- A feedback loop between dipeptide-repeat protein, TDP-43 and karyopherin-α mediates C9orf72-related neurodegeneration.
Solomon DA, Stepto A, Au WH, Adachi Y, Diaper DC, Hall R, Rekhi A, Boudi A, Tziortzouda P, Lee YB, Smith B, Bridi JC, Spinelli G, Dearlove J, Humphrey DM, Gallo JM, Troakes C, Fanto M, Soller M, Rogelj B, Parsons RB, Shaw CE, Hortobágyi T, Hirth F.
Brain 2018 Oct; 141(10):2908.
Application:IF, WB, Fruit fly, Human , Brains, Heads.
- Systematic Screening of Ubiquitin/p62 Aggregates in Cerebellar Cortex Expands the Neuropathological Phenotype of the C9orf72 Expansion Mutation.
Ramos-Campoy O, Ávila-Polo R, Grau-Rivera O, Antonell A, Clarimón J, Rojas-García R, Charif S, Santiago-Valera V, Hernandez I, Aguilar M, Almenar C, Lopez-Villegas D, Bajo L, Pastor P, Van der Zee J, Lladó A, Sanchez-Valle R, Gelpi E.
Journal of Neuropathology and Experimental Neurology 2018 Aug; 77(8):703.
Application:IHC-P, Human, Human brain.
- Chronic Administration of Pimozide Fails to Attenuate Motor and Pathological Deficits in Two Mouse Models of Amyotrophic Lateral Sclerosis.
Pozzi S, Thammisetty SS, Julien JP.
Neurotherapeutics : the Journal of the American Society for Experimental NeuroTherapeutics 2018 May; [Epub].
Application:IF, WB-Ti, Mouse, Lumbar spinal cord, Cerebral cortex.
- mTh1 driven expression of hTDP-43 results in typical ALS/FTLD neuropathological symptoms.
Scherz B, Rabl R, Flunkert S, Rohler S, Neddens J, Taub N, Temmel M, Panzenboeck U, Niederkofler V, Zimmermann R, Hutter-Paier B.
PLoS One 2018 May; 13(5):e0197674.
Application:IF, WB-Ti, Mouse, Brain, Hippocampal, Spinal cord.
- Gene Expression Profile in Frontal Cortex in Sporadic Frontotemporal Lobar Degeneration-TDP.
Andrés-Benito P, Gelpi E, Povedano M, Santpere G, Ferrer I.
Journal of Neuropathology and Eexperimental Neurology 2018 Jul; 77(7):608.
Application:IHC-P, Human, Brain.
- TAR DNA-Binding Protein 43 and Disrupted in Schizophrenia 1 Coaggregation Disrupts Dendritic Local Translation and Mental Function in Frontotemporal Lobar Degeneration.
Endo R, Takashima N, Nekooki-Machida Y, Komi Y, Hui KK, Takao M, Akatsu H, Murayama S, Sawa A, Tanaka M.
Biological Psychiatry 2018 Mar; [Epub].
Application:IHC-Fr, Human, Brain.
- Dysfunction of Protein Quality Control in Parkinsonism-Dementia Complex of Guam.
Verheijen BM, Oyanagi K, van Leeuwen FW.
Frontiers in Neurology 2018 Mar; 9:173.
Application:IHC-P, Human, Brains.
- The D2 Dopamine Receptor Interferes With the Protective Effect of the A2A Adenosine Receptor on TDP-43 Mislocalization in Experimental Models of Motor Neuron Degeneration.
Lai CY, Liu YJ, Lai HL, Chen HM, Kuo HC, Liao YP, Chern Y.
Frontiers in Neuroscience 2018 Mar; 12:187.
Application:IF, Mouse, Spinal cord sections.
- TDP-43 regulates the alternative splicing of hnRNP A1 to yield an aggregation-prone variant in amyotrophic lateral sclerosis.
Deshaies JE, Shkreta L, Moszczynski AJ, Sidibé H, Semmler S, Fouillen A, Bennett ER, Bekenstein U, Destroismaisons L, Toutant J, Delmotte Q, Volkening K, Stabile S, Aulas A, Khalfallah Y, Soreq H, Nanci A, Strong MJ, Chabot B, Vande Velde C.
Brain : A Journal of Neurology 2018 May; 141(5):1320.
Application:IP, Human, HeLa cells.
- TDP43 nuclear export and neurodegeneration in models of amyotrophic lateral sclerosis and frontotemporal dementia.
Archbold HC, Jackson KL, Arora A, Weskamp K, Tank EM, Li X, Miguez R, Dayton RD, Tamir S, Klein RL, Barmada SJ.
Scientific Reports 2018 Mar; 8(1):4606.
Application:ICC, WB, Rat, Brains, Primary cortical neurons.
- Cre-dependent AAV vectors for highly targeted expression of disease-related proteins and neurodegeneration in the substantia nigra.
Grames MS, Dayton RD, Jackson KL, Richard AD, Lu X, Klein RL.
FASEB Journal 2018 Mar; [Epub].
Application:IF, IHC, Rat, Substantia nigra.
- The First Historically Reported Italian Family with FTD/ALS Teaches a Lesson on C9orf72 RE: Clinical Heterogeneity and Oligogenic Inheritance.
Giannoccaro MP, Bartoletti-Stella A, Piras S, Casalena A, Oppi F, Ambrosetto G, Montagna P, Liguori R, Parchi P, Capellari S.
Journal of Alzheimer's Disease 2018 Feb; 62:687.
Application:IHC-P, Human, Brain.
- Towards a TDP-43-Based Biomarker for ALS and FTLD.
Feneberg E, Gray E, Ansorge O, Talbot K, Turner MR.
Molecular Neurobiology 2018 Feb; [Epub].
- Co-occurrence of mixed proteinopathies in late-stage Huntington's disease.
St-Amour I, Turgeon A, Goupil C, Planel E, Hébert SS.
Acta Neuropathologica 2018 Feb; 135(2):249.
Application:WB-Ti, Human , Brain from patient with Huntington's disease.
- Clusterin protects neurons against intracellular proteotoxicity.
Gregory JM, Whiten DR, Brown RA, Barros TP, Kumita JR, Yerbury JJ, Satapathy S, McDade K, Smith C, Luheshi LM, Dobson CM, Wilson MR.
Acta Neuropathologica Communications 2017 Nov; 5(1):81.
Application:WB-Tr, Mouse, N2a cells.
- Frontotemporal Dementia Caused by the P301L Mutation in the MAPT Gene: Clinicopathological Features of 13 Cases from the Same Geographical Origin in Barcelona, Spain.
Borrego-Écija S, Morgado J, Palencia-Madrid L, Grau-Rivera O, Reñé R, Hernández I, Almenar C, Balasa M, Antonell A, Molinuevo JL, Lladó A, Martínez de Pancorbo M, Gelpi E, Sánchez-Valle R.
Dementia and Geriatric Cognitive Disorders 2017 Sep; 44(3-4):213.
Application:IHC, Human, Brain from patients with frontotemporal dementia caused by the P301L mutation in the MAPT Gene.
- Incidental neuronal intermediate filament inclusion pathology: unexpected biopsy findings in a 37-year old woman with epilepsy.
Gelpi E, Carrato C, Grau-López L, Becerra JL, Garcia-Armengol R, Massuet A, Cervera L, Clarimon J, Beyer K, Álvarez R.
Neuropathology and Applied Neurobiology 2017 Dec; 43(7):636.
Application:IHC, Human, Human cerebral cortex.
- Drosophila lines with mutant and wild type human TDP-43 replacing the endogenous gene reveals phosphorylation and ubiquitination in mutant lines in the absence of viability or lifespan defects.
Chang JC, Morton DB.
PLoS One 2017 Jul; 12(7):e0180828.
Application:WB-Ti, Firefly, Fly heads.
- The unexpected co-occurrence of GRN and MAPT p.A152T in Basque families: Clinical and pathological characteristics.
Moreno F, Indakoetxea B, Barandiaran M, Caballero MC, Gorostidi A, Calafell F, Gabilondo A, Tainta M, Zulaica M, Martí Massó JF, López de Munain A, Sánchez-Juan P, Lee SE.
PLoS One 2017 Jun; 12(6):e0178093.
Application:IHC, Human, Brain from GRN+/A152T+ patient.
- Dioxins and related environmental contaminants increase TDP-43 levels.
Ash PEA, Stanford EA, Al Abdulatif A, Ramirez-Cardenas A, Ballance HI, Boudeau S, Jeh A, Murithi JM, Tripodis Y, Murphy GJ, Sherr DH, Wolozin B.
Molecular Neurodegeneration 2017 May; 12(1):35.
Application:WB, Human, Mouse, M17 neuroblastoma cells, Mouse brain.
- Motor-Coordinative and Cognitive Dysfunction Caused by Mutant TDP-43 Could Be Reversed by Inhibiting Its Mitochondrial Localization.
Wang W, Arakawa H, Wang L, Okolo O, Siedlak SL, Jiang Y, Gao J, Xie F, Petersen RB, Wang X.
Molecular Therapy 2017 Jan; 25(1):127.
Application:ICC, IF, WB-Ti, Mouse, Mouse brain.
- TBK1 Mutation Spectrum in an Extended European Patient Cohort With Frontotemporal Dementia and Amyotrophic Lateral Sclerosis.
van der Zee J, Gijselinck I, Van Mossevelde S, Perrone F, Dillen L, Heeman B, Bäumer V, Engelborghs S, De Bleecker J, Baets J, Gelpi E, Rojas-García R, Clarimón J, Lleó A, Diehl-Schmid J, Alexopoulos P, Perneczky R, Synofzik M, Just J, Schöls L, Graff C, Thonberg H, Borroni B, Padovani A, Jordanova A, Sarafov S, Tournev I, de Mendonça A, Miltenberger-Miltényi G, Simões do Couto F, Ramirez A, Jessen F, Heneka MT, Gómez-Tortosa E, Danek A, Cras P, Vandenberghe R, De Jonghe P, De Deyn PP, Sleegers.
Human Mutation 2017 Jan; 38(3):297.
Application:IHC-P, Human, Brain from patients with frontotemporal dementia and amyotrophic lateral sclerosis.
- Alzheimer neuropathology without frontotemporal lobar degeneration hallmarks (TAR DNA-binding protein 43 inclusions) in missense progranulin mutation Cys139Arg.
Redaelli V, Rossi G, Maderna E, Kovacs GG, Piccoli E, Caroppo P, Cacciatore F, Spinello S, Grisoli M, Sozzi G, Salmaggi A, Tagliavini F, Giaccone G.
Brain Pathology (Zurich, Switzerland) 2016 Dec; [Epub].
Application:IHC, Human, Brain from patients with Alzheimer neuropathology without frontotemporal lobar degeneration hallmarks.
- Withania somnifera Reverses Transactive Response DNA Binding Protein 43 Proteinopathy in a Mouse Model of Amyotrophic Lateral Sclerosis/Frontotemporal Lobar Degeneration.
Dutta K, Patel P, Rahimian R, Phaneuf D, Julien JP.
Neurotherapeutics : the Journal of the American Society for Experimental NeuroTherapeutics 2017 Apr; 14(2):447.
Application:IF, WB, Mouse, NSC34 cells, and spinal cord from transgenic mouse .
- The clinical, neuroanatomical, and neuropathologic phenotype of TBK1-associated frontotemporal dementia: A longitudinal case report.
Koriath CAM, Bocchetta M, Brotherhood E, Woollacott IOC, Norsworthy P, Simón-Sánchez J, Blauwendraat C, Dick KM, Gordon E, Harding SR, Fox NC, Crutch S,Warren JD, Revesz T, Lashley T, Mead S, Rohrer JD.
Alzheimer's & Dementia: Diagnosis, Assessment & Disease Monitoring 2016 Nov; 6:75.
Application:IHC, Human, Brain from patient with neuro-degeneration.
- Neuropathological criteria of anti-IgLON5-related tauopathy.
Gelpi E, Hoftberger R, Graus F, Ling H, Holton JL, Dawson T, Popovic M, Pretnar-Oblak J, Hogl B, Schmutzhard E, Poewe W, Ricken G, Santamaria J, Dalmau J, Budka H, Revesz T, Kovacs GG.
Acta Neuropathologica 2016 Oct; 132(4):531.
Application:IHC, Human, Brain.
- Altered Mitochondria, Protein Synthesis Machinery, and Purine Metabolism Are Molecular Contributors to the Pathogenesis of Creutzfeldt-Jakob Disease.
Ansoleaga B, Garcia-Esparcia P, Llorens F, Hernandez-Ortega K, Carmona Tech M, Antonio Del Rio J, Zerr I, Ferrer I.
Journal of Neuropathology and Experimental Neurology 2016 Jun; [Epub].
Application:IHC-P, Human, Human brain tissues.
- Increased cytoplasmic TARDBP mRNA in affected spinal motor neurons in ALS caused by abnormal autoregulation of TDP-43.
Koyama A, Sugai A, Kato T, Ishihara T, Shiga A, Toyoshima Y, Koyama M, Konno T, Hirokawa S, Yokoseki A, Nishizawa M, Kakita A, Takahashi H, Onodera O.
Nucleic Acids Research 2016 Jul; 44(12):5820.
Application:RIP-A, WB-Tr, Human, HEK 293T cells.
- Monocytes of patients with amyotrophic lateral sclerosis linked to gene mutations display altered TDP-43 subcellular distribution.
De Marco G, Lomartire A, Calvo A, Risso A, De Luca E, Mostert M, Mandrioli J, Caponnetto C, Borghero G, Manera U, Canosa A, Moglia C, Restagno G, Fini N, Tarella C, Giordana MT, Rinaudo MT, Chiò A.
Neuropathol Appl Neurobiol 2017 Feb; 43(2):133.
Application:IF, WB, Human, Circulating lymphomonocytes from patients with amyotrophic lateral sclerosis (ALS).
- Developmentally Regulated RNA-binding Protein 1 (Drb1)/RNA-binding Motif Protein 45 (RBM45), a Nuclear-Cytoplasmic Trafficking Protein, Forms TAR DNA-binding Protein 43 (TDP-43)-mediated Cytoplasmic Aggregates.
Mashiko T, Sakashita E, Kasashima K, Tominaga K, Kuroiwa K, Nozaki Y, Matsuura T, Hamamoto T, Endo H.
The Journal of Biological Chemistry 2016 Jul; 291(29):14996.
Application:WB-Ce, Human, HeLa cells.
- Pisa syndrome in a patient with pathologically confirmed Parkinson's disease.
Solla P, Grau O, Gelpi E, Marrosu F, Martí MJ.
Neuropathology and Applied Neurobiology 2016 Apr; 42(7):654.
Application:IHC, Human, Brain from patients with pathologically confirmed Parkinson's disease.
- Two mutations G335D and Q343R within the amyloidogenic core region of TDP-43 influence its aggregation and inclusion formation.
Jiang LL, Zhao J, Yin XF, He WT, Yang H, Che MX, Hu HY.
Scientific Reports 2016 Mar; 6:23928.
Application:Func, Human, HEK 293T cells.
- Methods for Prognostic and/or Diagnostic of Neurodegenerative Disease, Method to Identify Candidate Compounds and Compounds for Treating Neurodegenerative Disease.
Jean-Pierre Julien,Vivek Swarup.
United States Patent Application Publication 2016 Mar; [Epub].
Application:ELISA, WB-Ti, Mouse, Brain, Spinal cord, Muscle, Liver.
- Cytoplasmic mislocalization of RNA splicing factors and aberrant neuronal gene splicing in TDP-43 transgenic pig brain.
Wang G, Yang H, Yan S, Wang CE, Liu X, Zhao B, Ouyang Z, Yin P, Liu Z, Zhao Y, Liu T, Fan N, Guo L, Li S, Li XJ, Lai L.
Molecular Neurodegeneration 2015 Sep; 10(1):42.
Application:IF, WB-Ti, Human, Pig, Brain, Spinal cord.
- Hereditary leukoencephalopathy with axonal spheroids: a spectrum of phenotypes from CNS vasculitis to parkinsonism in an adult onset leukodystrophy series.
Lynch DS, Jaunmuktane Z, Sheerin UM, Phadke R, Brandner S, Milonas I, Dean A, Bajaj N, McNicholas N, Costello D, Cronin S, McGuigan C, Rossor M, Fox N, Murphy E, Chataway J, Houlden H.
Journal of Neurology, Neurosurgery, and Psychiatry 2015 May; 87(5):512.
Application:IHC-P, Human, Leukodystrophy.
- Early diagnosis of cardiac involvement in idiopathic inflammatory myopathy by cardiac magnetic resonance tomography.
Rosenbohm A, Buckert D, Gerischer N, Walcher T, Kassubek J, Rottbauer W, Ludolph AC, Bernhardt P.
Journal of Neurology 2015 Feb; 262(4):949.
Application:IHC-Fr, Human, Muscles.
- TDP-1, the Caenorhabditis elegans ortholog of TDP-43, limits the accumulation of double-stranded RNA.
Saldi TK, Ash PE, Wilson G, Gonzales P, Garrido-Lecca A, Roberts CM, Dostal V, Gendron TF, Stein LD, Blumenthal T, Petrucelli L, Link CD.
The EMBO Journal 2014 Dec; 33(24):2947.
Application:IF, WB-Tr, Human, HeLa, M17 cells.
- Neuropathological assessments of the pathology in frontotemporal lobar degeneration with TDP43-positive inclusions: an inter-laboratory study by the BrainNet Europe consortium.
Alafuzoff I, Pikkarainen M, Neumann M, Arzberger T, Al-Sarraj S, Bodi I, Bogdanovic N, Bugiani O, Ferrer I, Gelpi E, Gentleman S, Giaccone G, Graeber MB, Hortobagyi T, Ince PG, Ironside JW, Kavantzas N, King A, Korkolopoulou P, Kovacs GG, Meyronet D, Monoranu C, Nilsson T, Parchi P, Patsouris E, Revesz T, Roggendorf W, Rozemuller A, Seilhean D, Streichenberger N, Thal DR, Wharton SB, Kretzschmar H.
Journal of Neural Transmission (Vienna, Austria : 1996) 2015 Jul; 122(7):957.
Application:IHC-P, Human, Frontal cortex.
- A 6.4 Mb Duplication of the α-Synuclein Locus Causing Frontotemporal Dementia and Parkinsonism: Phenotype-Genotype Correlations.
Kara E, Kiely AP, Proukakis C, Giffin N, Love S, Hehir J, Rantell K, Pandraud A, Hernandez DG, Nacheva E, Pittman AM, Nalls MA, Singleton AB, Revesz T, Bhatia KP, Quinn N, Hardy J, Holton JL, Houlden H.
JAMA Neurology 2014 Sep; 71(9):1162.
Application:IHC-P, Human, Brain.
- A pathogenic progranulin mutation and C9orf72 repeat expansion in a family with frontotemporal dementia.
Lashley T, Rohrer JD, Mahoney C, Gordon E, Beck J, Mead S, Warren J, Rossor M, Revesz T.
Neuropathology and Applied Neurobiology 2014 Jun; 40(4):502.
Application:IF, IHC, Human, Brain, Hippocampus, Cerebellum.
- No interaction between tau and TDP-43 pathologies in either frontotemporal lobar degeneration or motor neurone disease.
Robinson AC, Thompson JC, Weedon L, Rollinson S, Pickering-Brown S, Snowden JS, Davidson YS, Mann DM.
Neuropathology and Applied Neurobiology 2014 Dec; 40(7):844.
- UBE2E Ubiquitin-conjugating Enzymes and Ubiquitin Isopeptidase Y Regulate TDP-43 Protein Ubiquitination.
Hans F, Fiesel FC, Strong JC, J?ckel S, Rasse TM, Geisler S, Springer W, Schulz JB, Voigt A, Kahle PJ.
The Journal of Biological Chemistry 2014 Jul; 289(27):19164.
Application:iF, WB-Ce, WB-Tr, Human, HEK293E cells.
- Interaction of transactive response DNA binding protein 43 with nuclear factor kappaB in mild cognitive impairment with episodic memory deficits.
Ohta Y, Tremblay C, Schneider JA, Bennett DA, Calon F, Julien JP.
Acta Neuropathologica Communications 2014 Apr; 2(1):37.
Application:IF, IP-WB, WB-Ti, Human, Brain cortex.
- Casein Kinase II Induced Polymerization of Soluble TDP-43 into Filaments Is Inhibited by Heat Shock Proteins.
Carlomagno Y, Zhang Y, Davis M, Lin WL, Cook C, Dunmore J, Tay W, Menkosky K, Cao X, Petrucelli L, Deture M.
PloS One 2014 Mar; 9(3):e90452.
Application:EM, Human, Parahippocampal gyrus.
- Disease-Associated Mutations of TDP-43 Promote Turnover of the Protein Through the Proteasomal Pathway.
Araki W, Minegishi S, Motoki K, Kume H, Hohjoh H, Araki YM, Tamaoka A.
Molecular Neurobiology 2014 Dec; 50(3):1049.
Application:ICC, WB-Tr, Human, SH-SY5Y cells.
- Reduced cellular Ca2+ availability enhances TDP-43 cleavage by apoptotic caspases.
De Marco G, Lomartire A, Mandili G, Lupino E, Buccinna B, Ramondetti C, Moglia C, Novelli F, Piccinini M, Mostert M, Rinaudo MT, Chio A, Calvo A.
Biochimica et Biophysica Acta 2014 Apr; 1843(4):725.
Application:WB-Re, Recombinant protein.
- Clinical And Neuropathological Variability In Clinically Isolated Central Nervous System Whipple's Disease.
Balasa M, Gelpi E, Rey MJ, Vila J, Ramio-Torrenta L, Quiles Granado AM, Molina Latorre R, Lepidi H, Raoult D, Saiz A.
Brain Pathology 2014 Apr; 24(3):230.
Application:IHC-P, Human, Brain.
- Multiple organ involvement by alpha-synuclein pathology in Lewy body disorders.
Gelpi E, Navarro-Otano J, Tolosa E, Gaig C, Compta Y, Rey MJ, Marti MJ, Hernandez I, Valldeoriola F, Rene R, Ribalta T.
Movement Disorders 2014 Jul; 29(8):1010.
Application:IHC, Human, Brain, spinal cord.
- Widespread RNA metabolism impairment in sporadic inclusion body myositis TDP43-proteinopathy.
Cortese A, Plagnol V, Brady S, Simone R, Lashley T, Acevedo-Arozena A, de Silva R, Greensmith L, Holton J, Hanna MG, Fisher EM, Fratta P.
Neurobiology of Aging 2014 Jun; 35(6):1491.
Application:IHC, Human, Muscle.
- TDP-43 Causes Differential Pathology in Neuronal versus Glial Cells in the Mouse Brain.
Yan S, Wang CE, Wei W, Gaertig MA, Lai L, Li S, Li XJ.
Human Molecular Genetics 2014 May; 23(10):2678.
Application:IF, IS, WB-Ti, WB-Tr, Human, Mouse, PC12 cells, Brain, Cortex, Hippocampus, Striatum, Cerebellum, Heart, Liver, Muscle, Lung, Kidney.
- Parkin reverses TDP-43-induced cell death and failure of amino acid homeostasis.
Hebron M, Chen W, Miessau MJ, Lonskaya I, Moussa CE.
Journal of Neurochemistry 2014 Apr; 129(2):350.
Application:WB-Ti, Mouse, Brain.
- Plasma phosphorylated TDP-43 levels are elevated in patients with frontotemporal dementia carrying a C9orf72 repeat expansion or a GRN mutation.
Suarez-Calvet M, Dols-Icardo O, Llado A, Sanchez-Valle R, Hernandez I, Amer G, Anton-Aguirre S, Alcolea D, Fortea J, Ferrer I, van der Zee J, Dillen L, Van Broeckhoven C, Molinuevo JL, Blesa R, Clarimon J, Lleo A.
Journal of Neurology, Neurosurgery, and Psychiatry 2014 Jun; 85(6):684.
Application:IHC, Human, Brain.
- The novel MAPT mutation K298E: mechanisms of mutant tau toxicity, brain pathology and tau expression in induced fibroblast-derived neurons.
Iovino M, Pfisterer U, Holton JL, Lashley T, Swingler RJ, Calo L, Treacy R, Revesz T, Parmar M, Goedert M, Muqit MM, Spillantini MG.
Acta Neuropathologica 2014 Feb; 127(2):283.
Application:IHC-P, Human, Brain.
- ALS-Associated TDP-43 Induces Endoplasmic Reticulum Stress, Which Drives Cytoplasmic TDP-43 Accumulation and Stress Granule Formation.
Walker AK, Soo KY, Sundaramoorthy V, Parakh S, Ma Y, Farg MA, Wallace RH, Crouch PJ, Turner BJ, Horne MK, Atkin JD.
PLoS One 2013 Nov; 8(11):e81170.
Application:ICC, WB-Tr, Human, Mouse, HeLa, Neuro2a cells, Spinal cords.
- Prominent psychiatric symptoms in patients with Parkinson's disease and concomitant argyrophilic grain disease.
Grau-Rivera O, Gelpi E, Rey MJ, Valldeoriola F, Tolosa E, Compta Y, Marti MJ.
Journal of Neurology 2013 Dec; 260(12):3002.
Application:IHC, Human, Human brain.
- The long non-coding RNA nuclear-enriched abundant transcript 1_2 induces paraspeckle formation in the motor neuron during the early phase of amyotrophic lateral sclerosis.
Nishimoto Y, Nakagawa S, Hirose T, Okano HJ, Takao M, Shibata S, Suyama S, Kuwako K, Imai T, Murayama S, Suzuki N, Okano H.
Molecular Brain 2013 Jul; 6:31.
Application:WB, Human, HeLa cells.
- Asymptomatic hyper-creatine-kinase-emia as sole manifestation of inclusion body myositis.
Finsterer J, Stollberger C, Kovacs GG.
Neurology International 2013 Jun; 5(2):34.
Application:IHC, Human, Muscle.
- Reduced cholinergic olfactory centrifugal inputs in patients with neurodegenerative disorders and MPTP-treated monkeys.
Mundinano IC, Hernandez M, Dicaudo C, Ordonez C, Marcilla I, Tunon MT, Luquin MR.
Acta Neuropathologica 2013 Sep; 126(3):411.
Application:IHC, Human, Monkey, Brain.
- Expression of ALS-linked TDP-43 mutant in astrocytes causes non-cell-autonomous motor neuron death in rats.
Tong J, Huang C, Bi F, Wu Q, Huang B, Liu X, Li F, Zhou H, Xia XG.
The EMBO Journal 2013 Jul; 32(13):1917.
Application:WB-Ce, Rat, Astrocytes.
- Globular glial-like inclusions in a patient with advanced Alzheimer's disease.
Gelpi E, Cullel F, Navarro-Otano J, Llado A.
Acta Neuropathologica 2013 Jul; 126(1):155.
Application:IHC, Human, Frontal cortex.
- Selective Forelimb Impairment in Rats Expressing a Pathological TDP-43 25 kDa C-terminal Fragment to Mimic Amyotrophic Lateral Sclerosis.
Dayton RD, Gitcho MA, Orchard EA, Wilson JD, Wang DB, Cain CD, Johnson JA, Zhang YJ, Petrucelli L, Mathis JM, Klein RL.
Molecular Therapy 2013 Jul; 21(7):1324.
Application:IHC, WB-Ti, Rat, Spinal cord.
- Cell injury and premature neurodegeneration in focal malformations of cortical development.
Iyer A, Prabowo A, Anink J, Spliet WG, van Rijen PC, Aronica E.
Brain Pathology 2014 Jan; 24(1):1.
Application:IHC-P, Human, Human brains.
- Neurodegenerative disease status and post-mortem pathology in idiopathic rapid-eye-movement sleep behaviour disorder: an observational cohort study.
Iranzo A, Tolosa E, Gelpi E, Molinuevo JL, Valldeoriola F, Serradell M, Sanchez-Valle R, Vilaseca I, Lomena F, Vilas D, Llado A, Gaig C, Santamaria J.
The Lancet. Neurology 2013 Apr; 12(5):443.
Application:IHC, Human, Brain.
- Reactive astrocytes secrete lcn2 to promote neuron death.
Bi F, Huang C, Tong J, Qiu G, Huang B, Wu Q, Li F, Xu Z, Bowser R, Xia XG, Zhou H.
PNAS 2013 May; 110(10):4069.
Application:IF,IHC, Rat, Rat brain.
- Primary progressive aphasia with parkinsonism: Clinicopathological case.
Doherty KM, Rohrer JD, Lees AJ, Holton JL, Warren J.
Movement Disorders Journal 2013 Jun; 28(6):741.
Application:IHC, Human, Human brain.
- Abnormal Regenerative Responses and Impaired Axonal Outgrowth after Nerve Crush in TDP-43 Transgenic Mouse Models of Amyotrophic Lateral Sclerosis.
Swarup V, Audet JN, Phaneuf D, Kriz J, Julien JP.
Journal of Neuroscience 2012 Dec; 32(50):18186.
Application:WB, Mouse, Spinal cord tissues.
- Parkin Ubiquitinates Tar-DNA Binding Protein-43 (TDP-43) and Promotes Its Cytosolic Accumulation via Interaction with Histone Deacetylase 6 (HDAC6).
Hebron ML, Lonskaya I, Sharpe K, Weerasinghe PP, Algarzae NK, Shekoyan AR, Moussa CE.
The Journal of Biological Chemistry 2013 Feb; 288(6):4103.
Application:WB-Ti, Mouse, Brain.
- Pick's pathology in Parkinson's disease with dementia.
Vilas D, Marti MJ, Botta-Orfila T, Colom-Cadena M, Gelpi E.
Neuropathology and Applied Neurobiology 2012 Dec; 38(7):737.
Application:IHC, Human, Brain.
- Accelerated Disease Onset with Stabilized Familial Amyotrophic Lateral Sclerosis (ALS)-linked Mutant TDP-43 Proteins.
Watanabe S, Kaneko K, Yamanaka K.
Journal of Biological Chemistry 2012 Dec; 288(5):3641.
Application:WB-Ce, Human, Neuro2a cell.
- XBP1 depletion precedes ubiquitin aggregation and Golgi fragmentation in TDP-43 transgenic rats.
Tong J, Huang C, Bi F, Wu Q, Huang B, Zhou H.
Journal of Neurochemistry 2012 Nov; 123(3):406.
Application:IHC, Rat, Neurons.
- Characterization of thorn-shaped astrocytes in white matter of temporal lobe in Alzheimer's disease brains.
López-González I, Carmona M, Blanco R, Luna-Muñoz J, Martínez-Mandonado A, Mena R, Ferrer I.
Brain Pathology 2013 Mar; 23(2):144.
Application:IHC-P, Human, Alzheimer's disease brains.
- TDP-43 plasma levels are higher in amyotrophic lateral sclerosis.
Verstraete E, Kuiperij HB, van Blitterswijk MM, Veldink JH, Schelhaas HJ, van den Berg LH, Verbeek MM.
Amyotrophic Lateral Sclerosis 2012 Sep; 13(5):446.
Application:ELISA, Human, Plasma from patients with amyotrophic lateral sclerosis.
- Atypical neuropathological sCJD-MM phenotype with abundant white matter Kuru-type plaques sparing the cerebellar cortex.
Gelpi E, Soler Insa JM, Parchi P, Saverioni D, Yagüe J, Nos C, Martínez-Saez E, Ribalta T, Ferrer I, Sanchez-Valle R.
europathology 2013 Apr; 33(2):204.
Application:IHC, Human, Brain from healthy 64-year-old diabetic man.
- MAPT H1 haplotype is associated with enhanced α-synuclein deposition in dementia with Lewy bodies.
Colom-Cadena M, Gelpi E, Martí MJ, Charif S, Dols-Icardo O, Blesa R, Clarimón J, Lleó A.
Neurobiology of Aging 2013 Mar; 34(3):936.
Application:IHC-P, Human, Brain from patients with dementia.
- Hirano body - rich subtypes of Creutzfeldt-Jakob disease.
Martinez-Saez E, Gelpi E, Rey M, Ferrer I, Ribalta T, Botta-Orfila T, Nos C, Yague J, Sanchez-Valle R.
Neuropathology and Applied Neurobiology 2012 Apr; 38(2):153.
Application:IHC-P, Human, Brain.
- Co-occurrence of different pathologies in dementia: implications for dementia diagnosis.
varri C, Burgmans S, Caballero MC, García-Bragado F, Verhey FR, Uylings HB.
Journal of Alzheimer's Disease: JAD 2012 Mar; 30(4):909.
Application:IHC-P, Human, Brain from patients with dementia.
- Wild type TDP-43 induces neuro-inflammation and alters APP metabolism in lentiviral gene transfer models.
Herman AM, Khandelwal PJ, Rebeck GW, Moussa CE.
Experimental Neurology 2012 May; 235(1):297.
Application:IHC, WB, Rat, Cortex.
- Breakpoint Sequence Analysis of an A?]PP Locus Duplication Associated with Autosomal Dominant Alzheimer's Disease and Severe Cerebral Amyloid Angiopathy.
Antonell A, Gelpi E, Sanchez-Valle R, Martinez R, Molinuevo JL, Llado A.
Journal of Alzheimer's Disease 2012 Jan; 28(2):303.
Application:IHC, Human, Human brains.
- An MND/ALS phenotype associated with C9orf72 repeat expansion: Abundant p62-positive, TDP-43-negative inclusions in cerebral cortex, hippocampus and cerebellum but without associated cognitive decline.
Troakes C, Maekawa S, Wijesekera L, Rogelj B, Siklos L, Bell C, Smith B, Newhouse S, Vance C, Johnson L, Hortobagyi T, Shatunov A, Al-Chalabi A, Leigh N, Shaw CE, King A, Al-Sarraj S.
Neuropathology 2011 Dec; 32(5):505.
Application:WB-Ti, Human, Frontal cortex from patients with the clinical features of a pure MND/ALS phenotype.
- Mutant TDP-43 in motor neurons promotes the onset and progression of ALS in rats.
Huang C, Tong J, Bi F, Zhou H, Xia XG.
The Journal of Clinical Investigation 2011 Dec; 122(1):107.
Application:IF, IHC, WB, Human, Motor neurons from mutant TDP-43 transgenic rats.
- Frontotemporal lobar degeneration related proteins induce only subtle memory-related deficits when bilaterally overexpressed in the dorsal hippocampus.
Dayton RD, Wang DB, Cain CD, Schrott LM, Ramirez JJ, King MA, Klein RL.
Experimental Neurology 2011 Dec; 233(2):807.
Application:IHC, Human, Human hippocampus, Rat hippocampus.
- TDP-43 regulates global translational yield by splicing of exon junction complex component SKAR.
Fiesel FC, Weber SS, Supper J, Zell A, Kahle PJ.
Nucleic Acids Research 2012 Mar; 40(6):2668.
Application:WB-Tr, Human, HEK293E, SH-SY5Y cells.
- Epitope mapping of antibodies against TDP-43 and detection of protease-resistant fragments of pathological TDP-43 in amyotrophic lateral sclerosis and frontotemporal lobar degeneration.
Tsuji H, Nonaka T, Yamashita M, Suzukake M, Kametani F, Akiyama H, Mann DM, Tamaoka A, Hasegawa M.
Biochemical and Biophysical Research Communications 2012 Jan; 417(1):116.
- Neurofibrillary tangle pathology and Braak staging in chronic epilepsy in relation to traumatic brain injury and hippocampal sclerosis: a post-mortem study.
Thom M, Liu JY, Thompson P, Phadke R, Narkiewicz M, Martinian L, Marsdon D, Koepp M, Caboclo L, Catarino CB, Sisodiya SM.
Brain 2011 Oct; 134(Pt 10):2969.
Application:IHC-P, Human, Human brains.
- The ALS-associated proteins FUS and TDP-43 function together to affect Drosophila locomotion and life span.
Wang JW, Brent JR, Tomlinson A, Shneider NA, McCabe BD.
The Journal of Clinical Investigation 2011 Oct; 121(10):4118.
Application:WB, Fly, Fly heads.
- Pathological hallmarks of amyotrophic lateral sclerosis/frontotemporal lobar degeneration in transgenic mice produced with TDP-43 genomic fragments.
Swarup V, Phaneuf D, Bareil C, Robertson J, Rouleau GA, Kriz J, Julien JP.
Brain 2011 Sep; 134(Pt 9):2610.
Application:IF, IHC, WB-Ti, Mouse, Brain, Muscle, Spinal cord, Heart, Liver, Kidney.
- Identification of c-myc-dependent proteins in the medulloblastoma cell line D425Med.
Azizi AA, Li L, Strobel T, Chen WQ, Slavc I, Lubec G.
Amino Acids 2012 Jun; 42(6):2149.
Application:WB-Ce, Human, D425Med cells.
- Molecular mechanisms of MLC1 and GLIALCAM mutations in megalencephalic leukoencephalopathy with subcortical cysts.
Lopez-Hernandez T, Sirisi S, Capdevila-Nortes X, Montolio M, Fernandez-Duenas V, Scheper GC, van der Knaap MS, Casquero P, Ciruela F, Ferrer I, Nunes V, Estevez R.
Human Molecular Genetics 2011 Aug; 20(16):3266.
Application:IF, Human, Brain.
- FTLD-TDP with motor neuron disease, visuospatial impairment and a progressive supranuclear palsy-like syndrome: broadening the clinical phenotype of TDP-43 proteinopathies. A report of three cases.
Rusina R, Kovacs GG, Fiala J, Hort J, Ridzon P, Holmerova I, Strobel T, Matej R.
BMC Neurology 2011 May; 11:50.
Application:IHC-P, Human, Brain.
- Increased dopaminergic cells and protein aggregates in the olfactory bulb of patients with neurodegenerative disorders.
Mundinano IC, Caballero MC, Ordonez C, Hernandez M, Dicaudo C, Marcilla I, Erro ME, Tunon MT, Luquin MR.
Acta Neuropathologica 2011 Jul; 122(1):61.
Application:IHC, Human, Olfactory bulb.
- Distribution and Pattern of Pathology in Subjects with Familial or Sporadic Late-Onset Cerebellar Ataxia as Assessed by p62/Sequestosome Immunohistochemistry.
Pikkarainen M, Hartikainen P, Soininen H, Alafuzoff I.
The Cerebellum 2011 Dec; 10(4):720.
Application:IHC, Human, Brain.
- Unusual clinical presentation and neuropathology in two subjects with fused-in sarcoma (FUS) positive inclusions.
Hartikainen PH, Pikkarainen M, Hanninen T, Soininen H, Alafuzoff I.
Neuropathology 2012 Feb; 32(1):60.
Application:IHC, Human, Fused-in sarcoma.
- Aggregation of the 35-kDa fragment of TDP-43 causes formation of cytoplasmic inclusions and alteration of RNA processing.
Che MX, Jiang YJ, Xie YY, Jiang LL, Hu HY.
FASEB Journal 2011 Jul; 25(7):2344.
Application:IF, WB, Human, HeLa cells.
- TDP-43 Potentiates Alpha-synuclein Toxicity to Dopaminergic Neurons in Transgenic Mice.
Tian T, Huang C, Tong J, Yang M, Zhou H, Xia XG.
Int J Biol Sci 2011 Mar; 7:234.
Application:IF, IHC, WB-Ti, Mouse, Skeletal muscle, Cerebellum, Cortex, Hippocampus, Brainstem, Spinal-cord.
- Beta-amyloid triggers ALS-associated TDP-43 pathology in AD models.
Herman AM, Khandelwal PJ, Stanczyk BB, Rebeck GW, Moussa CE.
Brain Research 2011 Apr; 1386:191.
Application:IHC, WB-Ti, Human , Human brains.
- TDP-43 pathology may occur in the BRI2 gene-related dementias.
Lashley T, Holton JL, Revesz T.
Acta Neuropathol 2011 Feb; 121:559.
Application:IHC-P, Human, Hippocampal.
- Cytoplasmic accumulation of TDP-43 in circulating lymphomonocytes of ALS patients with and without TARDBP mutations.
De Marco G, Lupino E, Calvo A, Moglia C, Buccinna B, Grifoni S, Ramondetti C, Lomartire A, Rinaudo MT, Piccinini M, Giordana MT, Chio A.
Acta Neuropathologica 2011 May; 121(5):611.
Application:WB, Human, Lymphomonocytes.
- Tubulin polymerization promoting protein (TPPP/p25) as a marker for oligodendroglial changes in multiple sclerosis.
Hoftberger R, Fink S, Aboul-Enein F, Botond G, Olah J, Berki T, Ovadi J, Lassmann H, Budka H, Kovacs GG.
Glia 2010 Nov; 58(15):1847.
Application:IHC-P, Human, Human brains.
- TDP-43 physically interacts with amyotrophic lateral sclerosis-linked mutant CuZn superoxide dismutase.
Higashi S, Tsuchiya Y, Araki T, Wada K, Kabuta T.
Neurochemistry International 2010 Dec; 57(8):906.
Application:WB-Tr, Monkey, COS-7 cells.
- Expansive Gene Transfer in the Rat CNS Rapidly Produces Amyotrophic Lateral Sclerosis Relevant Sequelae When TDP-43 is Overexpressed.
Wang DB, Dayton RD, Henning PP, Cain CD, Zhao LR, Schrott LM, Orchard EA, Knight DS, Klein RL.
Molecular Therapy 2010 Dec; 18(12):2064.
Application:IHC-Fr, Human, Human brains.
- Wild-type human TDP-43 expression causes TDP-43 phosphorylation, mitochondrial aggregation, motor deficits, and early mortality in transgenic mice.
Xu YF, Gendron TF, Zhang YJ, Lin WL, D'Alton S, Sheng H, Casey MC, Tong J, Knight J, Yu X, Rademakers R, Boylan K, Hutton M, McGowan E, Dickson DW, Lewis J, Petrucelli L.
Journal of Neuroscience 2010 Aug; 30(32):10851.
Application:IHC-P, Mouse, Brains, Spinal cords.
- ALS-associated mutations in TDP-43 increase its stability and promote TDP-43 complexes with FUS/TLS.
Ling SC, Albuquerque CP, Han JS, Lagier-Tourenne C, Tokunaga S, Zhou H, Cleveland DW.
PNAS 2010 Jul; 107(30):13318.
Application:IP, Recombinant protein.
- The first case of protease-sensitive prionopathy (PSPr) in The Netherlands: a patient with an unusual GSS-like clinical phenotype.
Jansen C, Head MW, van Gool WA, Baas F, Yull H, Ironside JW, Rozemuller AJ.
Journal of Neurology, Neurosurgery, and Psychiatry 2010 Sep; 81(9):1052.
Application:IHC-P, Human, Human brains.
- Neurotoxic effects of TDP-43 overexpression in C. elegans.
Ash PE, Zhang YJ, Roberts CM, Saldi T, Hutter H, Buratti E, Petrucelli L, Link CD.
Human Molecular Genetics 2010 Aug; 19(16):3206.
Application:WB-Tr, C. elegans, Human, HeLa cells, Transgenic worms.
- Nuclear import impairment causes cytoplasmic trans-activation response DNA-binding protein accumulation and is associated with frontotemporal lobar degeneration.
Nishimura AL, Zupunski V, Troakes C, Kathe C, Fratta P, Howell M, Gallo JM, Hortobágyi T, Shaw CE, Rogelj B.
Brain 2010 Jun; 133(Pt 6):1763.
Application:WB, Mouse, Human, N2a, SHSY-5Y cells.
- Mutations of optineurin in amyotrophic lateral sclerosis.
Maruyama H, Morino H, Ito H, Izumi Y, Kato H, Watanabe Y, Kinoshita Y, Kamada M, Nodera H, Suzuki H, Komure O, Matsuura S, Kobatake K, Morimoto N, Abe K, Suzuki N, Aoki M, Kawata A, Hirai T, Kato T, Ogasawara K, Hirano A, Takumi T, Kusaka H, Hagiwara K, Kaji R, Kawakami H.
Nature 2010 May; 465(7295):223.
Application:IHC-P, Human, Human spinal cords.
- Amyotrophic lateral sclerosis: dash-like accumulation of phosphorylated TDP-43 in somatodendritic and axonal compartments of somatomotor neurons of the lower brainstem and spinal cord.
Braak H, Ludolph A, Thal DR, Del Tredici K.
Acta Neuropathologica 2010 Jul; 120(1):67.
Application:IF, IHC-P, Human, Human brains.
- TDP-43 pathology in sporadic ALS occurs in motor neurons lacking the RNA editing enzyme ADAR2.
Aizawa H, Sawada J, Hideyama T, Yamashita T, Katayama T, Hasebe N, Kimura T, Yahara O, Kwak S.
Acta Neuropathologica 2010 Jul; 120(1):75.
Application:IHC, Human, Spinal cords.
- Depletion of oxidative and endoplasmic reticulum stress regulators in Pick disease.
Ilieva EV, Naudi A, Kichev A, Ferrer I, Pamplona R, Portero-Otin M.
Free Radical Biology & Medicine 2010 May; 48(10):1302.
Application:IHC-P, Human, Human brains.
- TDP-43 transgenic mice develop spastic paralysis and neuronal inclusions characteristic of ALS and frontotemporal lobar degeneration.
Wils H, Kleinberger G, Janssens J, Pereson S, Joris G, Cuijt I, Smits V, Ceuterick-de Groote C, Van Broeckhoven C, Kumar-Singh S.
PNAS 2010 Feb; 107(8):3858.
Application:IF, IHC-Fr, WB-Ti, Mouse, Mouse cortex.
- Alteration of biochemical and pathological properties of TDP-43 protein by a lipid mediator, 15-deoxy-Delta(12,14)-prostaglandin J(2).
Zhang HX, Tanji K, Yoshida H, Hayakari M, Shibata T, Mori F, Uchida K, Wakabayashi K.
Experimental Neurology 2010 Apr; 222(2):296.
Application:IF, WB, Human, Anterior horn cells, SKN-SH cells.
- Knockdown of transactive response DNA-binding protein (TDP-43) downregulates histone deacetylase 6.
Fiesel FC, Voigt A, Weber SS, Van den Haute C, Waldenmaier A, Gorner K, Walter M, Anderson ML, Kern JV, Rasse TM, Schmidt T, Springer W, Kirchner R, Bonin M, Neumann M, Baekelandt V, Alunni-Fabbroni M, Schulz JB, Kahle PJ.
The EMBO Journal 2010 Jan; 29(1):209.
Application:IF, WB-Tr, Human, HEK 293E cells.
- Characterization of alternative isoforms and inclusion body of the TAR DNA-binding protein-43.
Nishimoto Y, Ito D, Yagi T, Nihei Y, Tsunoda Y, Suzuki N.
The Journal of Biological Chemistry 2010 Jan; 285(1):608.
Application:WB-Ce, WB-Tr, Human, N2a, HeLa cells.
- Plasma phosphorylated-TDP-43 protein levels correlate with brain pathology in frontotemporal lobar degeneration.
Foulds PG, Davidson Y, Mishra M, Hobson DJ, Humphreys KM, Taylor M, Johnson N, Weintraub S, Akiyama H, Arai T, Hasegawa M, Bigio EH, Benson FE, Allsop D, Mann DM.
Acta Neuropathologica 2009 Nov; 118(5):647.
Application:ELISA, WB, Human, Human plasma.
- Abnormal hippocampal distribution of TDP-43 in patients with-late onset psychosis.
Velakoulis D, Walterfang M, Mocellin R, Pantelis C, Dean B, McLean C.
The Australian and New Zealand Journal of Psychiatry 2009 Aug; 43(8):739.
Application:IHC, Human, Hippocampus from patients with psychosis.
- Cytosolic TDP-43 expression following axotomy is associated with caspase 3 activation in NFL(-/-) mice: Support for a role for TDP-43 in the physiological response to neuronal injury.
Moisse K, Mepham J, Volkening K, Welch I, Hill T, Strong MJ.
Brain Research 2009 Nov; 1296:176.
Application:IHC, IF, Mouse, Spinal cord.
- Frontotemporal dementia presenting as schizophrenia-like psychosis in young people: clinicopathological series and review of cases.
Velakoulis D, Walterfang M, Mocellin R, Pantelis C, McLean C.
The British Journal of Psychiatry 2009 Apr; 194(4):298.
Application:IHC-Fr, Human, Human brains.
- The complement factor C5a receptor is upregulated in NFL-/- mouse motor neurons.
Humayun S, Gohar M, Volkening K, Moisse K, Leystra-Lantz C, Mepham J, McLean J, Strong MJ.
Journal of Neuroimmunology 2009 May; 210(1-2):52.
Application:IF, IHC-P, Human, Human spinal motor neurons.
- TAR DNA-Binding Protein 43 Accumulation in Protein Aggregate Myopathies.
Olive M, Janue A, Moreno D, Gamez J, Torrejon-Escribano B, Ferrer I.
Journal of Neuropathology and Experimental Neurology 2009 Mar; 68(3):262.
Application:IF, IHC-Fr, Human, Human muscle biopsies.
- VCP mutations causing frontotemporal lobar degeneration disrupt localization of TDP-43 and induce cell death.
Gitcho MA, Strider J, Carter D, Taylor-Reinwald L, Forman MS, Goate AM, Cairns NJ.
The Journal of Biological Chemistry 2009 May; 284(18):12384.
Application:IP, WB-Tr, Human, SH-SY5Y cells.
- Ubiquitin associated protein 1 is a risk factor for frontotemporal lobar degeneration.
Rollinson S, Rizzu P, Sikkink S, Baker M, Halliwell N, Snowden J, Traynor BJ, Ruano D, Cairns N, Rohrer JD, Mead S, Collinge J, Rossor M, Akay E, Guerreiro R, Rademakers R, Morrison KE, Pastor P, Alonso E, Martinez-Lage P, Graff-Radford N, Neary D, Heutin.
Neurobiology of Aging 2009 Apr; 30(4):656.
Application:IF, IHC, Human, Human brains.
- Expression Of TDP-43 C-terminal fragments in vitro recapitulates pathological features of TDP-43 proteinopathies.
Igaz LM, Kwong LK, Chen-Plotkin A, Winton MJ, Unger TL, Xu Y, Neumann M, Trojanowski JQ, Lee VM.
The Journal of Biological Chemistry 2009 Mar; 284(13):8516.
Application:IP, Human, Mouse, Human brains, N2a cells.
- Early-Onset Familial Lewy Body Dementia With Extensive Tauopathy: A Clinical, Genetic, and Neuropathological Study.
Clarimon J, Molina-Porcel L, Gomez-Isla T, Blesa R, Guardia-Laguarta C, Gonzalez-Neira A, Estorch M, Ma Grau J, Barraquer L, Roig C, Ferrer I, Lleo A.
Journal of Neuropathology and Experimental Neurology 2009 Jan; 68(1):73.
Application:IHC-P, Human, Brain from patient with early-onset Lewy body disease.
- Colocalization of Transactivation-Responsive DNA-Binding Protein 43 and Huntingtin in Inclusions of Huntington Disease.
Schwab C, Arai T, Hasegawa M, Yu S, McGeer PL.
Journal of Neuropathology and Experimental Neurology 2008 Dec; 67(12):1159.
Application:IHC, Human, CNS tissue.
- Increased TDP-43 protein in cerebrospinal fluid of patients with amyotrophic lateral sclerosis.
Kasai T, Tokuda T, Ishigami N, Sasayama H, Foulds P, Mitchell DJ, Mann DM, Allsop D, Nakagawa M.
Acta Neuropathologica 2008 Nov; 117(1):55.
Application:ELISA, IP, Human, Cerebrospinal fluid of patients with amyotrophic lateral sclerosis.
- TDP-43 in Cerebrospinal Fluid of Patients With Frontotemporal Lobar Degeneration and Amyotrophic Lateral Sclerosis.
Steinacker P, Hendrich C, Sperfeld AD, Jesse S, von Arnim CA, Lehnert S, Pabst A, Uttner I, Tumani H, Lee VM, Trojanowski JQ, Kretzschmar HA, Ludolph A, Neumann M, Otto M.
Archives of Neurology 2008 Nov; 65(11):1481.
Application:WB, Murine, Human, Neuroblastoma cells, Cerebrospinal fluids.
- Expression of collagen XVII and ubiquitin-binding protein p62 in motor neuron disease.
Seppanen A, Pikkarainen M, Hartikainen P, Hofmann SC, Majamaa K, Alafuzoff I.
Brain Research 2008 Nov; 1247:171.
Application:IHC-P, Human, Human hippocampus, medulla, motor cortex, spinal cord.
- Sporadic amyotrophic lateral sclerosis of long duration is associated with relatively mild TDP-43 pathology.
Nishihira Y, Tan CF, Hoshi Y, Iwanaga K, Yamada M, Kawachi I, Tsujihata M, Hozumi I, Morita T, Onodera O, Nishizawa M, Kakita A, Takahashi H.
Acta Neuropathologica 2009 Jan; 117(1):45.
Application:IEM, IHC, Human, Brains, Spinal cords,.
- Frontotemporal dementia in a large Swedish family is caused by a progranulin null mutation.
Skoglund L, Brundin R, Olofsson T, Kalimo H, Ingvast S, Blom ES, Giedraitis V, Ingelsson M, Lannfelt L, Basun H, Glaser A.
Neurogenetics 2009 Feb; 10(1):27.
Application:IHC-P, Human, Human brains, Human spinal cords.
- TDP-43 accumulation in inclusion body myopathy muscle suggests a common pathogenic mechanism with frontotemporal dementia.
Weihl CC, Temiz P, Miller SE, Watts G, Smith C, Forman M, Hanson PI, Kimonis V, Pestronk A.
J Neurol Neurosurg Psychiatry 2008 Oct; 79(10):1186.
Application:IF, IHC, WB-Ti, Human, Muscle tissue from patients with sporadic inclusion body myositis.
- Enduring involvement of tau, beta-amyloid, alpha-synuclein, ubiquitin and TDP-43 pathology in the amyotrophic lateral sclerosis/parkinsonism-dementia complex of Guam (ALS/PDC).
Miklossy J, Steele JC, Yu S, McCall S, Sandberg G, McGeer EG, McGeer PL.
Acta Neuropathologica 2008 Dec; 116(6):625.
Application:IHC, IF, Human, Brain.
- Divergent patterns of cytosolic TDP-43 and neuronal progranulin expression following axotomy: Implications for TDP-43 in the physiological response to neuronal injury.
Moisse K, Volkening K, Leystra-Lantz C, Welch I, Hill T, Strong MJ.
Brain Research 2009 Jan; 1249:202.
Application:IF, Mouse, Mouse spinal cord.
- White Matter Tauopathy With Globular Glial Inclusions: A Distinct Sporadic Frontotemporal Lobar Degeneration.
Kovacs GG, Majtenyi K, Spina S, Murrell JR, Gelpi E, Hoftberger R, Fraser G, Crowther RA, Goedert M, Budka H, Ghetti B.
Journal of Neuropathology and Experimental Neurology 2008 Oct; 67(10):963.
Application:IHC-P, Human, Brain from patient with frontotemporal lobar degeneration with abundant white matter globular glial tau pathology.
- Ultrastructural localization of TDP-43 in filamentous neuronal inclusions in various neurodegenerative diseases.
Lin WL, Dickson DW.
Acta Neuropathologica 2008 Jul; 116(2):205.
Application:IHC, Human, Brain from patients with Neurodegenerative Diseases.
- Maturation process of TDP-43-positive neuronal cytoplasmic inclusions in amyotrophic lateral sclerosis with and without dementia.
Mori F, Tanji K, Zhang HX, Nishihira Y, Tan CF, Takahashi H, Wakabayashi K.
Acta Neuropathologica 2008 Jun; 116(2):193.
Application:IF, IHC-P, Human, Brain and spinal cord from patients with amyotrophic lateral sclerosis.
- Molecular pathogenesis of frontotemporal lobar degeneration: basic science seminar in neurology.
Sleegers K, Kumar-Singh S, Cruts M, Van Broeckhoven C.
Archives of Neurology 2008 Jun; 65(6):700.
Application:IHC, Human, Human brains.
- Enrichment of C-Terminal Fragments in TAR DNA-Binding Protein-43 Cytoplasmic Inclusions in Brain but not in Spinal Cord of Frontotemporal Lobar Degeneration and Amyotrophic Lateral Sclerosis.
Igaz LM, Kwong LK, Xu Y, Truax AC, Uryu K, Neumann M, Clark CM, Elman LB, Miller BL, Grossman M, McCluskey LF, Trojanowski JQ, Lee VM.
The American Journal of Pathology 2008 Jun; 173(1):182.
Application:IF, IHC, Human, Spinal cord from patients with Amyotrophic Lateral Sclerosis.
- TDP-43 protein in plasma may index TDP-43 brain pathology in Alzheimer's disease and frontotemporal lobar degeneration.
Foulds P, McAuley E, Gibbons L, Davidson Y, Pickering-Brown SM, Neary D, Snowden JS, Allsop D, Mann DM.
Acta Neuropathologica 2008 May; 116(2):141.
Application:ELISA, Human, Plasma from patients with frontotemporal lobar degeneration (FTLD) and patients with Alzheimer’s disease (AD).
- A yeast TDP-43 proteinopathy model: Exploring the molecular determinants of TDP-43 aggregation and cellular toxicity.
Johnson BS, McCaffery JM, Lindquist S, Gitler AD.
PNAS 2008 Apr; 105(17):6439.
- A distinct clinical, neuropsychological and radiological phenotype is associated with progranulin gene mutations in a large UK series.
Beck J, Rohrer JD, Campbell T, Isaacs A, Morrison KE, Goodall EF, Warrington EK, Stevens J, Revesz T, Holton J, Al-Sarraj S, King A, Scahill R, Warren JD, Fox NC, Rossor MN, Collinge J, Mead S.
Brain 2008 Jan; 131(Pt 3):706.
Application:IHC, Human, Brain tissues from patients with frontotemporal lobar degeneration.
- Disturbance of nuclear and cytoplasmic Tar DNA binding protein (TDP-43) induces disease-like redistribution, sequestration and aggregate formation.
Winton MJ, Igaz LM, Wong MM, Kwong LK, Trojanowski JQ, Lee VM.
The Journal of Biological Chemistry 2008 Feb; 283(19):13302.
Application:WB, IF, Human, Mouse, Rat, undifferentiated (NT2-) and retinoic acid-treated differentiated neuronal (NT2N) human teratocarcinoma cells, undifferentiated (PC12) and neural growth factor-treated differentiated neural (dPC12) rat.
- Epitope mapping of 2E2-D3, a monoclonal antibody directed against human TDP-43.
Zhang HX, Tanji K, Mori F, Wakabayashi K.
Neuroscience Letters 2008 Feb; 434(2):170.
Application:WB, Human, Human brain, recombinant protein.
- Missense mutations in the progranulin gene linked to frontotemporal lobar degeneration with ubiquitin-immunoreactive inclusions reduce progranulin production and secretion.
Shankaran SS, Capell A, Hruscha AT, Fellerer K, Neumann M, Schmid B, Haass C.
The Journal of Biological Chemistry 2007 Nov; 283(3):1744.
Application:IF, Human, HeLa cells.
- MAPT S305I mutation: implications for argyrophilic grain disease.
Kovacs GG, Pittman A, Revesz T, Luk C, Lees A, Kiss E, Tariska P, Laszlo L, Molnar K, Molnar MJ, Tolnay M, de Silva R.
Acta Neuropathologica 2007 Dec; 116(1):103.
Application:IHC-P, Human, Granular layer of the dentate gyrus.
- Evidence That TDP-43 is Not the Major Ubiquitinated Target Within the Pathological Inclusions of Amyotrophic Lateral Sclerosis.
Sanelli T, Xiao S, Horne P, Bilbao J, Zinman L, Robertson J.
Journal of Neuropathology and Experimental Neurology 2007 Dec; 66(12):1147.
Application:IHC, Human, Lumbar spinal cords.
- FTLD-U linked missense mutations in the progranulin gene reduce progranulin production and secretion.
Shankaran SS, Capell A, Hruscha AT, Fellerer K, Neumann M, Schmid B, Haass C.
The Journal of Biological Chemistry 2007 Nov; 283:1744.
Application:WB, Human, HeLa, HEK 293T cells.
- TDP-43-immunoreactive neuronal and glial inclusions in the neostriatum in amyotrophic lateral sclerosis with and without dementia.
Zhang H, Tan CF, Mori F, Tanji K, Kakita A, Takahashi H, Wakabayashi K.
Acta Neuropathologica 2007 Sep; 115(1):115.
Application:IF, IHC-P, Human, Brain tissues from patients with amyotrophic lateral sclerosis (ALS).
- TDP-43 immunoreactivity in hippocampal sclerosis and Alzheimer's disease.
Amador-Ortiz C, Lin WL, Ahmed Z, Personett D, Davies P, Duara R, Graff-Radford NR, Hutton ML, Dickson DW.
Annals of Neurology 2007 Apr; 61(5):435.
Application:IHC-P, Human, Hippocampus from patients with Alzheimer’s disease (AD).
- Pathological TDP-43 distinguishes sporadic amyotrophic lateral sclerosis from amyotrophic lateral sclerosis with SOD1 mutations.
Mackenzie IR, Bigio EH, Ince PG, Geser F, Neumann M, Cairns NJ, Kwong LK, Forman MS, Ravits J, Stewart H, Eisen A, McClusky L, Kretzschmar HA, Monoranu CM, Highley JR, Kirby J, Siddique T, Shaw PJ, Lee VM, Trojanowski JQ.
Annals of Neurology 2007 May; 61(5):427.
Application:WB, Human, Human spinal cord.
- TDP-43 immunoreactivity in neuronal inclusions in familial amyotrophic lateral sclerosis with or without SOD1 gene mutation.
Tan CF, Eguchi H, Tagawa A, Onodera O, Iwasaki T, Tsujino A, Nishizawa M, Kakita A, Takahashi H.
Acta Neuropathologica 2007 Feb; 113(5):535.
Application:IHC-P, IF, Human, Lumbar anterior horn cell, neurons in the motor nucleus of the facial nerve.
- DEAD-box RNA helicase subunits of the Drosha complex are required for processing of rRNA and a subset of microRNAs.
Fukuda T, Yamagata K, Fujiyama S, Matsumoto T, Koshida I, Yoshimura K, Mihara M, Naitou M, Endoh H, Nakamura T, Akimoto C, Yamamoto Y, Katagiri T, Foulds C, Takezawa S, Kitagawa H, Takeyama K, O'Malley BW, Kato S.
Nature Cell Biology 2007 Apr; 9(5):604.
Application:WB, Mouse, Mouse kidney proximal tubule cells.
- TDP-43 is deposited in the Guam parkinsonism-dementia complex brains.
Hasegawa M, Arai T, Akiyama H, Nonaka T, Mori H, Hashimoto T, Yamazaki M, Oyanagi K.
Brain 2007 Apr; 130(Pt 5):1386.
Application:IF, IHC-Fr, WB, Human, Human Alzheimer's disease ( AD ) brain.
- TDP-43-positive white matter pathology in frontotemporal lobar degeneration with ubiquitin-positive inclusions.
Neumann M, Kwong LK, Truax AC, Vanmassenhove B, Kretzschmar HA, Van Deerlin VM, Clark CM, Grossman M, Miller BL, Trojanowski JQ, Lee VM.
Journal of Neuropathology and Experimental Neurology 2007 Mar; 66(3):177.
Application:IF, IHC-P, Human, Brain tissues from patients with frontotemporal lobar degeneration with ubiquitin-positive inclusions (FTLD-U).
- TDP-43 in the ubiquitin pathology of frontotemporal dementia with VCP gene mutations.
Neumann M, Mackenzie IR, Cairns NJ, Boyer PJ, Markesbery WR, Smith CD, Taylor JP, Kretzschmar HA, Kimonis VE, Forman MS.
Journal of Neuropathology and Experimental Neurology 2007 Feb; 66(2):152.
Application:IF, IHC-P, WB, Human, Brains from patients with bone and frontotemporal dementia (IBMPFD), and a clinical diagnosis of frontotemporal dementia (FTD).
- TDP-43 is a component of ubiquitin-positive tau-negative inclusions in frontotemporal lobar degeneration and amyotrophic lateral sclerosis.
Arai T, Hasegawa M, Akiyama H, Ikeda K, Nonaka T, Mori H, Mann D, Tsuchiya K, Yoshida M, Hashizume Y, Oda T.
Biochemical and Biophysical Research Communications 2006 Oct; 351(3):602.
Application:IHC-Fr, WB, Human, Human hippocampus, Human spinal cord.
- Rebalancing the motor circuit restores movement in a Caenorhabditis elegans model for TDP-43 toxicity.