Svbp (NM_024462) Mouse Tagged ORF Clone

Cat# MR200054

Size : 10ug

Request more information


Svbp (NM_024462) Mouse Tagged ORF Clone

SKU
MR200054
Ccdc23 (Myc-DDK-tagged) - Mouse coiled-coil domain containing 23 (Ccdc23), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

Bulk Requests & Clone Modifications
Specifications
Product Data
Target Symbol Svbp
Synonyms 2410005K17Rik; AI851162; Ccdc23
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR200054 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATCCACCTGCCCGGAAAGAAAAATCCAAAGTTAAAGAACCAGCCTTCAGAGTGGAGAAGGCTAAGC
AGAAATCTGCCCAGCAGGAGCTGAAGCAAAGACAGAGAGCAGAGATCTATGCTCTCAACAGAGTCATGAC
GGAGCTGGAGCAGCAGCAGTTTGATGAGTTCTGTAAGCAGATGCAGCCGCCTGGGGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR200054 protein sequence
Red=Cloning site Green=Tags(s)

MDPPARKEKSKVKEPAFRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_024462
ORF Size 201 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_024462.2, NP_077782.1
RefSeq Size 748 bp
RefSeq ORF 201 bp
Locus ID 69216
UniProt ID Q99LQ4
Cytogenetics 4 D2.1
MW 7.8 kDa
Summary Enhances the tyrosine carboxypeptidase activity of VASH1 and VASH2, thereby promoting the removal of the C-terminal tyrosine residue of alpha-tubulin (PubMed:29146868). Also required to enhance the solubility and secretion of VASH1 and VASH2 (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Svbp (NM_024462) Mouse Tagged ORF Clone
Your Rating
SKU Description Size
MC200194 Ccdc23 (untagged) - Mouse coiled-coil domain containing 23 (Ccdc23), transcript variant 2, (10ug) 10 ug
MR200054L3 Lenti ORF clone of Ccdc23 (Myc-DDK-tagged) - Mouse coiled-coil domain containing 23 (Ccdc23), transcript variant 2 10 ug
MR200054L4 Lenti ORF clone of Ccdc23 (mGFP-tagged) - Mouse coiled-coil domain containing 23 (Ccdc23), transcript variant 2 10 ug
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Products

  • cDNA Clones
  • Antibodies
  • Proteins
  • Vectors
  • RNAi
  • Gene Expression
  • Assay Kits
  • Tissues
  • Others

Product Support

  • Product FAQs
  • Product Manuals
  • SDS
  • Citations

Customer Support

  • Order Support
  • Technical Support
  • International Distributors
  • cDNA Clone Match
  • Product Review

Learning Resources

  • Video and Webinar
  • Brochures & Flyers
  • Protocols
  • Ebooks
  • Scientific Papers
  • Bioinformatics Tools

About Us

  • About Us
  • Press Releases
  • Conferences
  • Customer Testimonials
  • Careers
  • Legal Notices
  • Contact Us

You might also be interested by the following products:



Cat#
Description
Cond.
Price Bef. VAT