SLC39A6 (LIV1, ZIP6, Zinc Transporter ZIP6, Estrogen-regulated Protein LIV-1, Solute Carrier Family 39 Member 6, Zrt- and Irt-like Protein 6, ZIP-6) (FITC)

Cat# 138376-FITC-100ul

Size : 100ul

Brand : US Biological

Request more information



138376-FITC SLC39A6 (LIV1, ZIP6, Zinc Transporter ZIP6, Estrogen-regulated Protein LIV-1, Solute Carrier Family 39 Member 6, Zrt- and Irt-like Protein 6, ZIP-6) (FITC)

Clone Type
Polyclonal
Host
rabbit
Source
human
Isotype
IgG
Grade
Affinity Purified
Applications
IHC WB
Crossreactivity
Bo Ca Eq Gp Hu Mo Rt Sh
Shipping Temp
Blue Ice
Storage Temp
-20°C

Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A6 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.||Applications:|Suitable for use in Western Blot and Immunohistochemistry. Other applications have not been tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||Storage and Stability:|Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.||Note: Applications are based on unconjugated antibody.

Applications
Product Type: Pab|Isotype: IgG|Host: rabbit|Source: human|Concentration: As reported|Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).|Purity: Purified by Protein A affinity chromatography.|Immunogen: Synthetic peptide corresponding to the middle region, RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN, of human SLC39A6.|Specificity: Recognizes human SLC39A6. Species Crossreactivity: bovine, canine, guinea pig, equine, mouse, rat, sheep ||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Immunogen
Synthetic peptide corresponding to the middle region, RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN, of human SLC39A6.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human SLC39A6. Species Crossreactivity: bovine, canine, guinea pig, equine, mouse, rat, sheep