Recombinant Human Apolipoprotein H/ApoH (C-6His)

Cat# 32-7386-10

Size : 10ug

Brand : Abeomics


Recombinant Human Apolipoprotein H/ApoH (C-6His)



Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPCVDHHHHHH
Gene : APOH
Gene ID : 350
Uniprot ID : P02749
Source: Human Cells.
MW :37.29kD.
Recombinant Human Apolipoprotein H is produced by our Mammalian expression system and the target gene encoding Gly20-Ser345 is expressed with a 6His tag at the C-terminus. Apolipoprotein H (ApoH) is a 50 kDa variably glycosylated member of the complement control superfamily of proteins. Human ApoH is a major phospholipid binding protein and an important component to measure in the assessment of anti-phospholipid syndrome. Hepatocyte-derived ApoH binds to negatively charged phospholipids . It circulates as a component of lipoprotein particles and as a lipid-free serum protein. Human ApoH is also more specific than anti-cardiolipin antibodies and its presence correlates better with thrombotic risk. Mature human ApoH shares 76% and 82% aa sequence identity with mouse and rat ApoH.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Secreted
Tissue Specificity: Expressed by the liver and secreted in plasma.
BioGrid: 106847. 13 interactions.
There are currently no product reviews