PRKDC (DNA-dependent Protein Kinase Catalytic Subunit, DNA-PK Catalytic Subunit, DNA-PKcs, DNPK1, p460, HYRC, HYRC1)
Cat# 131815-100ug
Size : 100ug
Brand : US Biological
131815 Rabbit Anti-PRKDC (DNA-dependent Protein Kinase Catalytic Subunit, DNA-PK Catalytic Subunit, DNA-PKcs, DNPK1, p460, HYRC, HYRC1)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgGGrade
Affinity PurifiedApplications
E IHC WBCrossreactivity
HuAccession #
NM_006904, NP_008835Shipping Temp
Blue IceStorage Temp
-20°CThe PRKDC gene encodes the catalytic subunit of a nuclear DNA-dependent serine/threonine protein kinase (DNA-PK). The second component is the autoimmune antigen Ku (MIM 152690), which is encoded by the G22P1 gene on chromosome 22q. On its own, the catalytic subunit of DNA-PK is inactive and relies on the G22P1 component to direct it to the DNA and trigger its kinase activity; PRKDC must be bound to DNA to express its catalytic properties.[supplied by OMIM]||Applications:|Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested.||Recommended Dilution:|Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml|Optimal dilutions to be determined by the researcher.||AA Sequence:|KMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGWEPWM||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.