- More Files
- Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant PAX2.
Immunogen
PAX2 (NP_000269, 194 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (82)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Transfected lysate)
Western Blot analysis of PAX2 expression in transfected 293T cell line by PAX2 monoclonal antibody (M01), clone 3C7.
Lane 1: PAX2 transfected lysate(47.41 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PAX2 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 0.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PAX2 is 0.03 ng/ml as a capture antibody.ELISA
- Gene Info — PAX2
Entrez GeneID
5076GeneBank Accession#
NM_000278Protein Accession#
NP_000269Gene Name
PAX2
Gene Alias
-
Gene Description
paired box 2
Gene Ontology
HyperlinkGene Summary
PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq
Other Designations
OTTHUMP00000020286|OTTHUMP00000020287|paired box gene 2|paired box homeotic gene 2|paired box protein 2
- Interactomes
- Diseases
- Publication Reference
- Generation of two induced pluripotent stem cell lines from individuals without auditory disorders.
Shota Okura, Honoka Ishii, Ayano Suzuki, Chika Saegusa, Ko Fujiki, Kenshi Sugano, Noriomi Suzuki, Tsubasa Saeki, Saeko Matsuzaki, Hiroyuki Ozawa, Masato Fujioka, Makoto Hosoya, Hideyuki Okano.
Stem Cell Research 2023 Jan; 67:103017.
Application:IF, Human, Human peripheral blood mononuclear cells (PBMCs).
- Upregulation of the hypothalamo-neurohypophysial system and activation of vasopressin neurones attenuates hyperalgesia in a neuropathic pain model rat.
Kazuhiko Baba, Makoto Kawasaki, Haruki Nishimura, Hitoshi Suzuki, Takanori Matsuura, Naofumi Ikeda, Teruaki Fujitani, Yoshiaki Yamanaka, Manabu Tsukamoto, Hideo Ohnishi, Mitsuhiro Yoshimura, Takashi Maruyama, Kenya Sanada, Satomi Sonoda, Kazuaki Nishimura, Kentaro Tanaka, Tatsushi Onaka, Yoichi Ueta, Akinori Sakai.
Scientific Reports 2022 Jul; 12(1):13046.
Application:IF, Rat, Spinal dorsal horn.
- Analysis of the proportion and neuronal activity of excitatory and inhibitory neurons in the rat dorsal spinal cord after peripheral nerve injury.
Yasuhito Motojima, Yoichi Ueta, Akinori Sakai.
Neuroscience Letters 2021 Feb; 749:135707.
Application:IF, IHC-Fr, Rat, Rat spinal cord.
- Neurodevelopmental impairment induced by prenatal valproic acid exposure shown with the human cortical organoid-on-a-chip model.
Kangli Cui, Yaqing Wang, Yujuan Zhu, Tingting Tao, Fangchao Yin, Yaqiong Guo, Haitao Liu, Fei Li, Peng Wang, Yuejun Chen, Jianhua Qin.
Microsystems & Nanoengineering 2020 Jul; 6:49.
Application:IF, IHC-Fr, Human, Human cortical organoids.
- Ablation of spinal cord estrogen receptor α-expressing interneurons reduces chemically-induced modalities of pain and itch.
May Tran, Joao Manuel Braz, Katherine Hamel, Julia Kuhn, Andrew J Todd, Allan I Basbaum.
The Journal of Comparative Neurology 2020 Jul; 528(10):1629.
Application:IF, IHC-Fr, Mouse, Mouse spinal cords.
- The histone demethylase LSD1 regulates inner ear progenitor differentiation through interactions with Pax2 and the NuRD repressor complex.
Patel D, Shimomura A, Majumdar S, Holley MC, Hashino E.
PLoS One 2018 Jan; 13(1):e0191689.
Application:WB, Mouse, N33 cells.
- Engineering stem cell-derived 3D brain organoids in a perfusable organ-on-a-chip system.
Yaqing Wang, Li Wang, Yaqiong Guo, Yujuan Zhu, Jianhua Qin.
RSC Advances 2018 Jan; 8(3):1677.
Application:IF, Brain.
- Probing impaired neurogenesis in human brain organoids exposed to alcohol.
Zhu Y, Wang L, Yin F, Yu Y, Wang Y, Shepard MJ, Zhuang Z, Qin J.
Integrative Biology : Quantitative Biosciences from Nano to Macro 2017 Dec; 9(12):968.
Application:IHC-Fr, Human, Human brain organoids.
- In situ generation of human brain organoids on a micropillar array.
Zhu Y, Wang L, Yu H, Yin F, Wang Y, Liu H, Jiang L, Qin J.
Lab on A Chip 2017 Aug; 17(17):2941.
Application:IHC-Fr, Human, Human brain.
- Repression of Interstitial Identity in Nephron Progenitor Cells by Pax2 Establishes the Nephron-Interstitium Boundary during Kidney Development.
Natalie Naiman, Kaoru Fujioka, Mari Fujino, M Todd Valerius, S Steven Potter, Andrew P McMahon, Akio Kobayashi.
Developmental Cell 2017 May; 41(4):349.
Application:IF, Mouse, Mouse kidney.
- Cerebral organoids model human brain development and microcephaly.
Lancaster MA, Renner M, Martin CA, Wenzel D, Bicknell LS, Hurles ME, Homfray T, Penninger JM, Jackson AP, Knoblich JA.
Nature 2013 Sep; 501(7467):373.
Application:IF, Human, Brain.
- Generation of inner ear sensory epithelia from pluripotent stem cells in 3D culture.
Koehler KR, Mikosz AM, Molosh AI, Patel D, Hashino E.
Nature 2013 Aug; 500(7461):217.
Application:IHC-Fr, Mouse, Mouse inner ear sensory epithelia.
- Ontogeny-recapitulating generation and tissue integration of ES cell?Vderived Purkinje cells.
Muguruma K, Nishiyama A, Ono Y, Miyawaki H, Mizuhara E, Hori S, Kakizuka A, Obata K, Yanagawa Y, Hirano T, Sasai Y.
Nature Neuroscience 2010 Oct; 13(10):1171.
Application:IHC-P, Mouse, Mouse brains.
- Generation of two induced pluripotent stem cell lines from individuals without auditory disorders.