MUC5AC (Mucin 5AC, Oligomeric Mucus/gel-Forming, MUC5) (Biotin)
Cat# 249029-Biotin-100ul
Size : 100ul
Brand : US Biological
249029-Biotin Rabbit Anti-MUC5AC (Mucin 5AC, Oligomeric Mucus/gel-Forming, MUC5) (Biotin)
Clone Type
PolyclonalHost
mouseIsotype
IgG2b,kGrade
PurifiedApplications
E WBAccession #
XP_495860Shipping Temp
Blue IceStorage Temp
-20°CMouse monoclonal antibody raised against a partial recombinant MUC5AC.||Applications: |Suitable for use in Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|NQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQH||Storage and Stability:|Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. ||Note: Applications are based on unconjugated antibody.