Human Protease protein
Cat# orb419333-20ug
Size : 20ug
Brand : Biorbyt
Human Protease protein
Catalog Number: orb419333
| Catalog Number | orb419333 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human adenovirus C serotype 5 Protease |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 28.1 kDa |
| UniProt ID | P03253 |
| Protein Sequence | MGSSEQELKAIVKDLGCGPYFLGTYDKRFPGFVSPHKLACAIVNTAGRETGGVHWMAFAWNPHSKTCYLFEPFGFSDQRLKQVYQFEYESLLRRSAIASSPDRCITLEKSTQSVQGPNSAACGLFCCMFLHAFANWPQTPMDHNPTMNLITGVPNSMLNSPQVQPTLRRNQEQLYSFLERHSPYFRSHSAQIRSATSFCHLKNM |
| Protein Length | Full Length |
| Source | E.coli |
| Biological Origin | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) |
| Expression Region | 1-204aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Adenain Adenovirus protease |
| Note | For research use only |
| Application notes | Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-204aaSequence Info: Full Length |
| Expiration Date | 6 months from date of receipt. |