Human H2AFX,H2AX protein
Cat# orb54644-20ug
Size : 20ug
Brand : Biorbyt
Human H2AFX,H2AX protein
Catalog Number: orb54644
Catalog Number | orb54644 |
---|---|
Category | Proteins |
Description | Recombinant human H2AFX,H2AX protein |
Reactivity | Human |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 17.8 kDa |
Target | H2AFX,H2AX |
UniProt ID | P16104 |
Protein Sequence | RAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQ |
Protein Length | Partial |
Source | E.coli |
Expression System | 12-141aa |
Expression Region | 12-141aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Note | For research use only |
Application notes | N-terminal 6xHis-tagged: N-terminal 6xHis-tagged24-255AA: 12-141AAPartial : Partial |
Expiration Date | 6 months from date of receipt. |