Human Fusion glycoprotein F0 protein
Cat# orb419334-100ug
Size : 100ug
Brand : Biorbyt
Human Fusion glycoprotein F0 protein
Catalog Number: orb419334
Catalog Number | orb419334 |
---|---|
Category | Proteins |
Description | Recombinant Human respiratory syncytial virus A Fusion glyco F0 |
Tag | N-terminal 6xHis-B2M-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 69.9 kDa |
UniProt ID | P03420 |
Protein Sequence | NITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITT |
Protein Length | Extracellular Domain |
Source | E.coli |
Biological Origin | Human respiratory syncytial virus A (strain A2) |
Expression Region | 27-529aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | F, Fusion glycoprotein F0, Protein F) [Cleaved int |
Note | For research use only |
Application notes | Tag Info: N-terminal 6xHis-B2M-taggedExpression Region: 27-529aaSequence Info: Full Length |
Expiration Date | 6 months from date of receipt. |