Human CD24 protein
Cat# orb245463-100ug
Size : 100ug
Brand : Biorbyt
Human CD24 protein
Catalog Number: orb245463
| Catalog Number | orb245463 |
|---|---|
| Category | Proteins |
| Description | Human CD24 protein |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 32.3 kDa |
| UniProt ID | P25063 |
| Protein Sequence | SETTTGTSSNSSQSTSNTGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS |
| Protein Length | Full Length of Mature Protein |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 27-80aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | CD 24 protein, CD24 protein, CD-24 protein , CD24 |
| Note | For research use only |
| Application notes | This is GST-tag protein |
| Expiration Date | 6 months from date of receipt. |