Western Blot (Transfected lysate)
Western Blot analysis of HOXB7 expression in transfected 293T cell line (H00003217-T01) by HOXB7 MaxPab polyclonal antibody.
Lane 1: HOXB7 transfected lysate(24.00 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab rabbit antibody to HOXB7 on HeLa cell. [antibody concentration 10 ug/ml]
- Specifications
Product Description
Rabbit polyclonal antibody raised against a full-length human HOXB7 protein.
Immunogen
HOXB7 (AAH15345.1, 1 a.a. ~ 217 a.a) full-length human protein.
Sequence
MSSLYYANALFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Transfected lysate)
Western Blot analysis of HOXB7 expression in transfected 293T cell line (H00003217-T01) by HOXB7 MaxPab polyclonal antibody.
Lane 1: HOXB7 transfected lysate(24.00 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab rabbit antibody to HOXB7 on HeLa cell. [antibody concentration 10 ug/ml] - Gene Info — HOXB7
Entrez GeneID
3217GeneBank Accession#
BC015345.1Protein Accession#
AAH15345.1Gene Name
HOXB7
Gene Alias
HHO.C1, HOX2, HOX2C, Hox-2.3
Gene Description
homeobox B7
Omim ID
142962Gene Ontology
HyperlinkGene Summary
This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma. [provided by RefSeq
Other Designations
homeo box 2C|homeo box B7|homeo box c1 protein
- Interactomes
- Diseases
- Publication Reference
- Expression of HOXB7 in the Lung of Patients with Idiopathic Pulmonary Fibrosis: A Proof-of-Concept Study.
Anna Valeria Samarelli., Roberto Tonelli., Giulia Raineri., Ilenia Mastrolia., Matteo Costantini., Luca Fabbiani., Virginia Catani., Tiziana Petrachi., Giulia Bruzzi., Dario Andrisani., Filippo Gozzi., Alessandro Marchioni., Valentina Masciale., Beatrice Aramini., Valentina Ruggieri., Giulia Grisendi., Massimo Dominici., Stefania Cerri., Enrico Clini.
Biomedicines 2024 Jun; 12(6):1321.
Application：IHC, Human, Lung tissue samples.
- Thalidomide suppresses migration and invasion of colorectal cancer cells by inhibiting HOXB7-mediated activation of the Wnt/β-catenin signaling pathway.
Liyang Liu, Wusong Xue.
Chemical Biology & Drug Design 2024 Jan; 103(1):e14434.
Application：WB, Human , SW480 and Caco-2 cells.
- Microfragmented adipose tissue is associated with improved ex vivo performance linked to HOXB7 and b-FGF expression.
Giulia Casari, Elisa Resca, Andrea Giorgini, Olivia Candini, Tiziana Petrachi, Maria Serena Piccinno, Elisabetta Manuela Foppiani, Lucrezia Pacchioni, Marta Starnoni, Massimo Pinelli, Giorgio De Santis, Filippo Selleri, Fabio Catani, Massimo Dominici, Elena Veronesi.
Stem Cell Research & Therapy 2021 Aug; 12(1):481.
Application：IHC-P, Human, Human adipose tissue-derivated mesenchymal stromal/stem cells, Human microfragmented adipose tissue.
- MicroRNA miR-196a is a central regulator of HOX-B7 and BMP4 expression in malignant melanoma.
Braig S, Mueller DW, Rothhammer T, Bosserhoff AK.
Cellular and Molecular Life Sciences 2010 Oct; 67(20):3535.
Application：IF, Human, Mel Im cells, NHEMs.
- Expression of HOXB7 in the Lung of Patients with Idiopathic Pulmonary Fibrosis: A Proof-of-Concept Study.