- More Files
Western Blot (Cell lysate)
HD monoclonal antibody (M11), clone 3F1 Western Blot analysis of HD expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Cell lysate)
HD monoclonal antibody (M11), clone 3F1. Western Blot analysis of HD expression in U-2 OS ( Cat # L022V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HD on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HD is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
- Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen
HD (NP_002102, 81 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Cell lysate)
HD monoclonal antibody (M11), clone 3F1 Western Blot analysis of HD expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
HD monoclonal antibody (M11), clone 3F1. Western Blot analysis of HD expression in U-2 OS ( Cat # L022V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HD on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HD is approximately 0.3ng/ml as a capture antibody.ELISA
- Gene Info — HTT
- Interactomes
- Diseases