- More Files
Western Blot (Cell lysate)
DTX3L monoclonal antibody (M01), clone 1D10 Western Blot analysis of DTX3L expression in A-431 ( Cat # L015V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to DTX3L on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 6 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DTX3L is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.62 KDa) .
- Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant DTX3L.
Immunogen
DTX3L (NP_612144, 3 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SHLRPPSPLLVRVYKSGPRVRRKLESYFQSSKSSGGGECTVSTQEHEAPGTFRVEFSERAAKERVLKKGEHQILVDEKPVPIFLVPTENSIKKNTRPQISSLTQSQAE
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Cell lysate)
DTX3L monoclonal antibody (M01), clone 1D10 Western Blot analysis of DTX3L expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to DTX3L on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 6 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DTX3L is approximately 0.3ng/ml as a capture antibody.ELISA
- Gene Info — DTX3L
- Interactomes
- Pathways