Anti-ATOH1 (Atonal Homolog 1 (Drosophila), ATH1, HATH1, MATH-1, bHLHa14) Monoclonal Antibody

This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. [provided by RefSeq||Applications: |Suitable for use in ELISA, Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELGASEMouse monoclonal antibody raised against a full length recombinant ATOH1.PRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCK||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.