Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595 protein
Cat# orb705020-100ug
Size : 100ug
Brand : Biorbyt
Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595 protein
Catalog Number: orb705020
| Catalog Number | orb705020 |
|---|---|
| Category | Proteins |
| Description | Recombinant Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595 |
| Tag | C-terminal hFc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| MW | 35.7 kDa |
| UniProt ID | Q9GZ28 |
| Protein Sequence | MASFLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSC |
| Protein Length | Full Length of Mature Protein |
| Source | Mammalian cell |
| Biological Origin | Anemonia sulcata (Mediterranean snakelocks sea anemone) |
| Expression Region | 1-62aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | asFP595 |
| Note | For research use only |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |