ACB1, Recombinant, Saccharomyces cerevisiae, aa1-87, His-Tag (Acyl-CoA-binding Protein)
Cat# 372121-100ug
Size : 100ug
Brand : US Biological
372121 Rabbit Anti-ACB1, Recombinant, Saccharomyces cerevisiae, aa1-87, His-Tag (Acyl-CoA-binding Protein)
Clone Type
PolyclonalSwiss Prot
P31787Grade
PurifiedShipping Temp
Blue IceStorage Temp
-20°CBinds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters.||Source:|Recombinant protein corresponding to aa1-87 from saccharomyces cerevisiae ACB1, fused to His-Tag at N-terminal, expressed in Yeast.||Molecular Weight: |~12.1kD||AA Sequence:|MVSQLFEEKAKAVNELPTKPSTDELLELYALYKQATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQEDAEKEYIALVDQLIAKYSS||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.