LEPROTL1 antibody
Cat# orb326676-100ul
Size : 100ul
Brand : Biorbyt
Item 1 of 4
Item 1 of 4
LEPROTL1 antibody
Catalog Number: orb326676
Catalog Number | orb326676 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to LEPROTL1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human LEPROTL1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 14kDa |
Target | LEPROTL1 |
UniProt ID | O95214 |
Protein Sequence | Synthetic peptide located within the following region: FVLFFYILSPIPYCIARRLVDDTDAMSNACKELAIFLTTGIVVSAFGLPI |
NCBI | NP_056159 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti HSPC112 antibody, anti Vps55 antibody, anti m |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: LEPROTL1, Sample Type: Fetal Liver lysates, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target Name: LEPROTL1, Sample Type: Human 721_B, Antibody Dilution: 1.0 ug/mL, LEPROTL1 is supported by BioGPS gene expression data to be expressed in 721_B.
Host: Rabbit, Target Name: LEPROTL1, Sample Type: Human Hela, Antibody Dilution: 1.0 ug/mL, LEPROTL1 is supported by BioGPS gene expression data to be expressed in HeLa.
Host: Rabbit, Target Name: LEPROTL1, Sample Type: Human HepG2, Antibody Dilution: 1.0 ug/mL, LEPROTL1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.