- More Files
- Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant HNF4A.
Immunogen
HNF4A (NP_000448, 324 a.a. ~ 423 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Cell lysate)
HNF4A monoclonal antibody (M05), clone 1F12 Western Blot analysis of HNF4A expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to HNF4A on HeLa cell. [antibody concentration 10 ug/ml] - Gene Info — HNF4A
Entrez GeneID
3172GeneBank Accession#
NM_000457Protein Accession#
NP_000448Gene Name
HNF4A
Gene Alias
FLJ39654, HNF4, HNF4a7, HNF4a8, HNF4a9, MODY, MODY1, NR2A1, NR2A21, TCF, TCF14
Gene Description
hepatocyte nuclear factor 4, alpha
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq
Other Designations
HNF4-alpha|OTTHUMP00000031060|OTTHUMP00000031062|hepatic nuclear factor 4 alpha|hepatocyte nuclear factor 4 alpha|transcription factor-14
- Interactomes
- Pathways
- Diseases