Images
QC Test

  • Specifications

    Product Description

    Human CSF2RA full-length ORF ( AAH02635.1, 1 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength

    Sequence

    MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT

    Host

    Wheat Germ (in vitro)

    Theoretical MW (kDa)

    69.74

    Interspecies Antigen Sequence

    Mouse (35); Rat (32)

    Preparation Method

    in vitro wheat germ expression system

    Purification

    Glutathione Sepharose 4 Fast Flow

    Quality Control Testing

    12.5% SDS-PAGE Stained with Coomassie Blue.

    Storage Buffer

    50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

    Storage Instruction

    Store at -80°C. Aliquot to avoid repeated freezing and thawing.

    Note

    Best use within three months from the date of receipt of this protein.

  • Applications

    Enzyme-linked Immunoabsorbent Assay

    Western Blot (Recombinant protein)

    Antibody Production

    Protein Array

  • Gene Info — CSF2RA

    Entrez GeneID

    1438

    GeneBank Accession#

    BC002635

    Protein Accession#

    AAH02635.1

    Gene Name

    CSF2RA

    Gene Alias

    CD116, CDw116, CSF2R, CSF2RAX, CSF2RAY, CSF2RX, CSF2RY, GM-CSF-R-alpha, GMCSFR, GMR, MGC3848, MGC4838

    Gene Description

    colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage)

    Omim ID

    306250 425000

    Gene Ontology

    Hyperlink

    Gene Summary

    The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble. [provided by RefSeq

    Other Designations

    CD116 antigen|GM-CSF receptor alpha subunit|OTTHUMP00000014504|OTTHUMP00000014505|OTTHUMP00000014917|OTTHUMP00000014918|colony stimulating factor 2 receptor alpha chain|colony stimulating factor 2 receptor alpha subunit|granulocyte-macrophage colony-stimu

  • Interactomes
  • Pathways
  • Diseases