UTS2D antibody
Cat# orb585257-100ul
Size : 100ul
Brand : Biorbyt
UTS2D antibody
Catalog Number: orb585257
Catalog Number | orb585257 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to UTS2D |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Mouse |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 13kDa |
Target | UTS2B |
UniProt ID | Q765I0 |
Protein Sequence | Synthetic peptide located within the following region: ALPNKLEELNQLEKLKEQLVEEKDSETSYAVDGLFSSHPSKRACFWKYCV |
NCBI | NP_937795 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | U2B, URP, UIIB, U-IIB, UTS2D |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-UTS2D Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell.