TGDS antibody
Cat# orb325954-100ul
Size : 100ul
Brand : Biorbyt
TGDS antibody
Catalog Number: orb325954
Catalog Number | orb325954 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TGDS |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TGDS |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 40kDa |
Target | TGDS |
UniProt ID | O95455 |
Protein Sequence | Synthetic peptide located within the following region: DEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSYWEQYKFPVVITR |
NCBI | NP_055120 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti TDPGD antibody, anti SDR2E1 antibody |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-TGDS Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: A549 cell lysate.