PIK3CB monoclonal antibody (M03), clone 10D5
* The price is valid only in USA. Please select country.
- More Files
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between PIK3R1 and PIK3CB. HeLa cells were stained with anti-PIK3R1 rabbit purified polyclonal 1:1200 and anti-PIK3CB mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Immunofluorescence
Immunofluorescence of monoclonal antibody to PIK3CB on HeLa cell . [antibody concentration 20 ug/ml]
Western Blot detection against Immunogen (37.84 KDa) .
- Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant PIK3CB.
Immunogen
PIK3CB (NP_006210, 147 a.a. ~ 256 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (87)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Recombinant protein)
ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between PIK3R1 and PIK3CB. HeLa cells were stained with anti-PIK3R1 rabbit purified polyclonal 1:1200 and anti-PIK3CB mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to PIK3CB on HeLa cell . [antibody concentration 20 ug/ml] - Gene Info — PIK3CB
Entrez GeneID
5291GeneBank Accession#
NM_006219Protein Accession#
NP_006210Gene Name
PIK3CB
Gene Alias
DKFZp779K1237, MGC133043, PI3K, PI3KCB, PI3Kbeta, PIK3C1, p110-BETA
Gene Description
phosphoinositide-3-kinase, catalytic, beta polypeptide
Omim ID
602925Gene Ontology
HyperlinkGene Summary
Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110-kD catalytic subunit, such as PIK3CB, and an 85-kD adaptor subunit (Hu et al., 1993 [PubMed 8246984]).[supplied by OMIM
Other Designations
PI3-kinase p110 subunit beta|PtdIns-3-kinase p110|phosphatidylinositol 3-kinase, catalytic, beta polypeptide
- Interactomes
- Pathways
- Diseases
