- More Files
- Specifications
Product Description
Rabbit polyclonal antibody raised against partial recombinant human NRCAM.
Immunogen
Recombinant protein corresponding to human NRCAM.
Sequence
REDYICYARFNHTQTIQQKQPISVKVISVDELNDTIAANLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTPIIYWAKEDGMLPKNRTVYKNFEKTLQIIHVSEADSGNYQC
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Applications
Western Blot (Cell lysate)
Western Blot analysis of A-549 cell lysate with NRCAM polyclonal antibody (Cat # PAB31432).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with NRCAM polyclonal antibody (Cat # PAB31432) shows distinct positivity in neuropil. - Gene Info — NRCAM
Entrez GeneID
4897Protein Accession#
Q92823Gene Name
NRCAM
Gene Alias
KIAA0343, MGC138845, MGC138846
Gene Description
neuronal cell adhesion molecule
Omim ID
601581Gene Ontology
HyperlinkGene Summary
Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. This gene encodes a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. This gene is also expressed in non-neural tissues and may play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of this gene have been associated with autism and addiction vulnerability. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
NgCAM-related cell adhesion molecule|NrCAM-|bravo
- Interactomes
- Pathways
- Diseases
- Publication Reference
- Differential expression of neural markers in KIT and PDGFRA wild-type gastrointestinal stromal tumours.
Pantaleo MA, Astolfi A, Nannini M, Ceccarelli C, Formica S, Santini D, Heinrich MC, Corless C, Dei Tos AP, Paterini P, Catena F, Maleddu A, Saponara M, Di Battista M, Biasco G.
Histopathology 2011 Dec; 59(6):1071.
Application:IHC-P, Human, Human gastrointestinal stromal tumours.
- Differential expression of neural markers in KIT and PDGFRA wild-type gastrointestinal stromal tumours.