IFNK (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
- More Files
- Specifications
Product Description
Human IFNK partial ORF ( NP_064509, 35 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
VHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.19
Interspecies Antigen Sequence
Mouse (35); Rat (38)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
- Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
- Gene Info — IFNK
Entrez GeneID
56832GeneBank Accession#
NM_020124Protein Accession#
NP_064509Gene Name
IFNK
Gene Alias
RP11-27J8.1
Gene Description
interferon, kappa
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the type I interferon family. Type I interferons are a group of related glycoproteins that play an important role in host defenses against viral infections. This protein is expressed in keratinocytes and the gene is found on chromosome 9, adjacent to the type I interferon cluster. [provided by RefSeq
Other Designations
OTTHUMP00000021169|interferon kappa|interferon-like protein
- Pathways
- Diseases