GFP-like Non-fluorescent Chromoprotein FP595, Recombinant, Anemonia sulcata, aa1-62, hFC-Tag
Cat# 584663-20ug
Size : 20ug
Brand : US Biological
584663 GFP-like Non-fluorescent Chromoprotein FP595, Recombinant, Anemonia sulcata, aa1-62, hFC-Tag
Clone Type
PolyclonalSwiss Prot
Q9GZ28Grade
PurifiedShipping Temp
Blue IceStorage Temp
-20°CPigment protein that is intensely purple in color.||Source:|Recombinant protein corresponding to aa1-62 from Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595, fused to FC-Tag at C-terminal, expressed in Mammalian cell.||Molecular Weight: |~35.7kD||Amino Acid Sequence:|MASFLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSC||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Applications
Source: Recombinant, Mammalian cell|Purity: ≥85% (SDS-PAGE)|Concentration: As Reported |Form: Supplied as a liquid in Tris, pH 8.0, 6% trehalose, 50% glycerol||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a liquid in Tris, pH 8.0, 6% trehalose, 50% glycerol
Purity
≥85% (SDS-PAGE)