Human H2AFX,H2AX protein
Cat# orb54644-20ug
Size : 20ug
Brand : Biorbyt
Human H2AFX,H2AX protein
Catalog Number: orb54644
| Catalog Number | orb54644 |
|---|---|
| Category | Proteins |
| Description | Recombinant human H2AFX,H2AX protein |
| Reactivity | Human |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 17.8 kDa |
| Target | H2AFX,H2AX |
| UniProt ID | P16104 |
| Protein Sequence | RAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQ |
| Protein Length | Partial |
| Source | E.coli |
| Expression System | 12-141aa |
| Expression Region | 12-141aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Note | For research use only |
| Application notes | N-terminal 6xHis-tagged: N-terminal 6xHis-tagged24-255AA: 12-141AAPartial : Partial |
| Expiration Date | 6 months from date of receipt. |