GATA2 (Endothelial Transcription Factor GATA-2, GATA-binding Protein 2, MGC2306)
Cat# 127184-100ug
Size : 100ug
Brand : US Biological
127184 GATA2 (Endothelial Transcription Factor GATA-2, GATA-binding Protein 2, MGC2306)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgG2a,kGrade
Affinity PurifiedApplications
E IF WBCrossreactivity
HuAccession #
BC018988, AAH18988Shipping Temp
Blue IceStorage Temp
-20°CGATA2 is a member of the GATA family of zinc-finger transcription factors that are named for the consensus nucleotide sequence they bind in the promoter regions of target genes. This protein plays an essential role in regulating transcription of genes involved in the development and proliferation of hematopoietic and endocrine cell lineages.||Applications:|Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested.||Recommended Dilution:|Immunofluorescence: 10ug/ml|Optimal dilutions to be determined by the researcher.||AA Sequence:|MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGK||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.