Transcription factor PU.1, Recombinant, Human, aa1-270, His-tag (SPI1)
Cat# 406052-20ug
Size : 20ug
Brand : US Biological
406052 Rabbit Anti-Transcription factor PU.1, Recombinant, Human, aa1-270, His-tag (SPI1)
Clone Type
PolyclonalSwiss Prot
P17947Grade
PurifiedShipping Temp
Blue IceStorage Temp
-20°CBinds to the PU-box, a purine-rich DNA sequence (5'-GAGGAA-3') that can act as a lymphoid-specific enhancer. This protein is a transcriptional activator that may be specifically involved in the differentiation or activation of macrophages or B-cells. Also binds RNA and may modulate pre-mRNA splicing.||Source:|Recombinant protein corresponding to aa1-270 from human Transcription factor PU.1, fused to His-tag at N-terminal, expressed in E. coli.||Molecular Weight: |~35.1kD||AA Sequence:|MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH||Storage and Stability: |May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.