Images
QC Test

  • Specifications

    Product Description

    Human TNFSF8 full-length ORF ( NP_001235.1, 1 a.a. - 234 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength

    Sequence

    MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD

    Host

    Wheat Germ (in vitro)

    Theoretical MW (kDa)

    52.4

    Interspecies Antigen Sequence

    Mouse (70)

    Preparation Method

    in vitro wheat germ expression system

    Purification

    Glutathione Sepharose 4 Fast Flow

    Quality Control Testing

    12.5% SDS-PAGE Stained with Coomassie Blue.

    Storage Buffer

    50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

    Storage Instruction

    Store at -80°C. Aliquot to avoid repeated freezing and thawing.

    Note

    Best use within three months from the date of receipt of this protein.

  • Applications

    Enzyme-linked Immunoabsorbent Assay

    Western Blot (Recombinant protein)

    Antibody Production

    Protein Array

  • Gene Info — TNFSF8

    Entrez GeneID

    944

    GeneBank Accession#

    NM_001244.2

    Protein Accession#

    NP_001235.1

    Gene Name

    TNFSF8

    Gene Alias

    CD153, CD30L, CD30LG, MGC138144

    Gene Description

    tumor necrosis factor (ligand) superfamily, member 8

    Omim ID

    603875

    Gene Ontology

    Hyperlink

    Gene Summary

    The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancies. The engagement of this cytokine expressed on B cell surface plays an inhibitory role in modulating Ig class switch. This cytokine was shown to enhance cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines. The pleiotropic biologic activities of this cytokine on different CD30+ lymphoma cell lines may play a pathophysiologic role in Hodgkin's and some non-Hodgkin's lymphomas. [provided by RefSeq

    Other Designations

    CD153 antigen|CD30 antigen ligand|CD30 ligand|OTTHUMP00000022762

  • Interactomes
  • Pathways
  • Diseases

    + View More Disease

    - View Less Disease