RpsJ, Recombinant, E. coli, aa1-103, GST-Tag 30S Ribosomal Protein S10)

Involved in the binding of tRNA to the ribosomes.||Source:|Recombinant protein corresponding to aa1-103 from E. coli 30S Ribosomal Protein S10, fused to GST-Tag at N-terminal, expressed in E. coli. ||Molecular Weight: |~38.7kD||Amino Acid Sequence:|MQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.