Outer Membrane Protein C, Recombinant E. coli, aa22-367, His-Tag (ompC)
Cat# 518038-100ug
Size : 100ug
Brand : US Biological
518038 Rabbit Anti-Outer Membrane Protein C, Recombinant E. coli, aa22-367, His-Tag (ompC)
Clone Type
PolyclonalSwiss Prot
P06996Grade
PurifiedShipping Temp
Blue IceStorage Temp
-20°CForms pores that allow passive diffusion of small molecules across the outer membrane.||Source:|Recombinant protein corresponding to aa22-367 of E. coli Outer Membrane Protein C, fused to 6xHis-Tag at N-terminal, expressed in E. coli.||Molecular Weight: |~42.3kD||Amino Acid Sequence:|AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.