GFP-like Non-Fluorescent Chromoprotein FP595, Recombinant, Anemonia sulcata, aa1-62, GST-Tag

Pigment protein that is intensely purple in color.||Source:|Recombinant protein corresponding to aa1-62 from Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595, fused to GST-Tag at N-terminal, expressed in E.coli.||Molecular Weight: |~33.5kD||Amino Acid Sequence:|MASFLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSC||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.