Acidic Protein MsyB, Recombinant, E. coli, aa1-124, His-tag (msyB)
Cat# 405859-20ug
Size : 20ug
Brand : US Biological
405859 Rabbit Anti-Acidic Protein MsyB, Recombinant, E. coli, aa1-124, His-tag (msyB)
Clone Type
PolyclonalSwiss Prot
P25738Grade
PurifiedShipping Temp
Blue IceStorage Temp
-20°CCould participate in the normal pathway of protein export.||Source:|Full-length recombinant protein corresponding to aa1-124 from E. coli Acidic Protein MsyB, fused to His-tag at C-terminal, expressed in Baculovirus.||Molecular Weight: |~16.3kD||Amino Acid Sequence:|MTMYATLEEAIDAAREEFLADNPGIDAEDANVQQFNAQKYVLQDGDIMWQVEFFADEGEEGECLPMLSGEAAQSVFDGDYDEIEIRQEWQEENTLHEWDEGEFQLEPPLDTEEGRAAADEWDER||Storage and Stability: |May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.