ACB1, Recombinant, Saccharomyces cerevisiae, aa1-87, His-Tag (Acyl-CoA-binding Protein)

Cat# 372121-20ug

Size : 20ug

Brand : US Biological



372121 Rabbit Anti-ACB1, Recombinant, Saccharomyces cerevisiae, aa1-87, His-Tag (Acyl-CoA-binding Protein)

Clone Type
Polyclonal
Swiss Prot
P31787
Grade
Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C

Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters.||Source:|Recombinant protein corresponding to aa1-87 from saccharomyces cerevisiae ACB1, fused to His-Tag at N-terminal, expressed in Yeast.||Molecular Weight: |~12.1kD||AA Sequence:|MVSQLFEEKAKAVNELPTKPSTDELLELYALYKQATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQEDAEKEYIALVDQLIAKYSS||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications
Source: Recombinant, Yeast|Purity: ≥90% (SDS-PAGE)|Concentration: As Reported |Form: Supplied as a liquid in Tris, 50% glycerol.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a liquid in Tris, 50% glycerol.
Purity
≥90% (SDS-PAGE)
References
1. "Quantitative trait loci mapped to single-nucleotide resolution in yeast." Deutschbauer A.M., Davis R.W.Nat. Genet. 37:1333-1340(2005).