SYP (Synaptophysin, Major Synaptic Vesicle Protein p38)

Cat# 134147-100ug

Size : 100ug

Brand : US Biological

Request more information



134147 SYP (Synaptophysin, Major Synaptic Vesicle Protein p38)

Clone Type
Polyclonal
Host
mouse
Source
human
Isotype
IgG1,k
Grade
Affinity Purified
Applications
E WB
Crossreactivity
Hu
Accession #
BC064550, AAH64550
Shipping Temp
Blue Ice
Storage Temp
-20°C

Synaptophysin (p38) is an abundant integral membrane protein of small synaptic vesicles in the brain. It is also present in endocrine cells, where it is associated with small electron-translucent vesicles. Synaptophysin expression has been widely used as a marker for synaptogenesis in developmental studies in vivo and in vitro and as a marker for neuron-specific cell lineages in tumors of the central nervous system and of peripheral neuroendocrine cell derivation. It has multiple transmembrane regions and a cytoplasmic tail that contains 10 copies of a tyrosine-rich repeat. Biochemical experiments have demonstrated that it transverses the membrane four times and has cytoplasmic carboxyl- and amino-termini. It also contain unstable intramolecular disulfide bonds that spontaneously rearrange, thereby creating higher-order polymers that are larger than the native protein and that have distinctly different biochemical properties. Mutations involving the synaptophysin gene may be responsible for an X-linked disorder. Chromosomal localization of the human gene for synaptophysin established the human SYP locus on the X chromosome in subbands Xpll.22-pll.23. It is involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane.||Applications:|Suitable for use in ELISA and Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLNVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDLVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Applications
Product Type: Mab|Isotype: IgG1,k|Clone No: 3B3|Host: mouse|Source: human|Concentration: As Reported |Form: Supplied as a liquid in PBS, pH 7.2.|Purity: Purified by Protein A affinity chromatography.|Immunogen: Full length recombinant corresponding to aa1-314 from human SYP (AAH64550) with GST tag. MW of the GST tag alone is 26kD.|Specificity: Recognizes human SYP.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Immunogen
Full length recombinant corresponding to aa1-314 from human SYP (AAH64550) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human SYP.