Recombinant Human Interferon gamma Receptor 1/IFNGR1 (C-6His)

Cat# 32-8450-10

Size : 10ug

Brand : Abeomics

Request more information


Recombinant Human Interferon gamma Receptor 1/IFNGR1 (C-6His)



Amount : 50 µg
Content : Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Storage condition : Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
AA sequence : EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGVDHHHHHH
Gene : IFNGR1
Gene ID : 3459
Uniprot ID : P15260
Source: Human Cells.
MW :28.7kD.
Recombinant Human Interferon gamma receptor 1 is produced by our Mammalian expression system and the target gene encoding Glu18-Ser245 is expressed with a 6His tag at the C-terminus. Interferon gamma receptor 1(IFNGR1) encoded by the IFNGR1 gene, is a single-pass type 1 membrane protein which belongs to the type II cytokine receptor family. IFNGR1 is phosphorylated at Ser/Thr residues after translation. IFNGR1 is a receptor for interferon gamma, two receptors bind one interferon gama dimer. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.

Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Cell membrane
Post transnational modification: Phosphorylated at Ser/Thr residues.
BioGrid: 109681. 31 interactions.
There are currently no product reviews