- More Files
- Specifications
Product Description
Human IL17 partial ORF ( NP_002181.1, 24 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Interspecies Antigen Sequence
Mouse (60); Rat (59)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
- Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
- Gene Info — IL17A
Entrez GeneID
3605GeneBank Accession#
NM_002190Protein Accession#
NP_002181.1Gene Name
IL17A
Gene Alias
CTLA8, IL-17, IL-17A, IL17
Gene Description
interleukin 17A
Omim ID
603149Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. [provided by RefSeq
Other Designations
OTTHUMP00000016597|cytotoxic T-lymphocyte-associated antigen 8|cytotoxic T-lymphocyte-associated protein 8|cytotoxic T-lymphocyte-associated serine esterase 8|interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8)
- Interactomes
- Pathways
- Diseases