COVID-19 Nucleoprotein BioAssay™ ELISA Kit (Universal) (Research Use Only)

Cat# 544128-96T

Size : 96Tests

Brand : US Biological



544128 COVID-19 Nucleoprotein BioAssay™ ELISA Kit (Universal) (Research Use Only)

Clone Type
Polyclonal
Shipping Temp
RT
Storage Temp
-20°C

The COVID-19 nucleoprotein BioAssay™ ELISA Kit is a quantitative sandwich assay for the in vitro detection of nucleoprotein in serum, plasma, tissue homogenates, cell culture supernatant, cell culture lysate and other biological fluids (throat swab, nose swab).||Range:|62.5-4000pg/ml||Sensitivity:|<37.5pg/ml||Reactivity:|Coronavirus (COVID-19, SARS-CoV-2, 2019-nCoV)||AA Sequence:|MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSP|DDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLP|QGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQG|QTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEV|TPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQ|QSMSSADSTQA||Test Principle (Research Use Only):|This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Capture antibody (monoclonal) was precoated onto 96-well plates. And the biotin conjugated antibody(monoclonal) was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to|visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the target amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of target can be calculated.||Precision:|Intra-assay CV: <8%|Inter-assay CV: <10%||Kit Components:|ELISA Microplate(Dismountable), 96Tests|Lyophilized Standard, 2x vial|Sample/Standard Dilution Buffer, 20ml|Biotin-labeled Antibody(Concentrated), 1x120ul (protect from light)|Antibody Dilution Buffer, 1x10ml|HRP-Streptavidin Conjugate(SABC), 1x120ul (protect from light)|SABC Dilution Buffer, 1x10ml|TMB Substrate, 1x10ml (protect from light)|Stop Solution, 1x10ml|Wash Buffer(25X), 1x30ml||Storage and Stability:|Store unopened ELISA Microplate at 4ºC; store at -20ºC once opened. Store unopened Lyophilized Standard at 4°C; once reconstituted, store at 4°C for up to 12 hours or at -20°C for up to 48 hours. Store other components at 4°C. Kit is stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vials after thawing and prior to removing the cap.||Assay Summary:|1. Wash plate 2 times before adding standards and samples to wells!|2. Add 100ul standard or sample to each well and incubate for 90 minutes at 37°C. Aspirate and wash 2 times.|3. Add 100ul Antibody (Biotin) working solution to each well and incubate for 60 minutes at 37°C. |4. Aspirate and wash 3 times.|5. Add 100ul SABC working solution to each well. Incubate for 30 minutes at 37°C|6. Aspirate and wash 5 times.|7. Add 90ul TMB substrate. Incubate 15-30 minutes at 37°C|8. Add 50ul Stop Solution. Read at 450nm immediately.|9. Calculate results

Applications
Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. Toxicity and Hazards: All products should be handled by qualified personnel only, trained in laboratory procedures.