COLEC12 (CLP1, NSR2, SCARA4, SRCL, Collectin-12, Collectin Placenta Protein 1, Nurse Cell Scavenger Receptor 2, Scavenger Receptor Class A Member 4, Scavenger Receptor with C-type Lectin) (HRP)
Cat# 125196-HRP-100ul
Size : 100ul
Brand : US Biological
125196-HRP Rabbit Anti-COLEC12 (CLP1, NSR2, SCARA4, SRCL, Collectin-12, Collectin Placenta Protein 1, Nurse Cell Scavenger Receptor 2, Scavenger Receptor Class A Member 4, Scavenger Receptor with C-type Lectin) (HRP)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgG2a,kGrade
Affinity PurifiedApplications
E WBCrossreactivity
HuAccession #
BC060789, AAH60789Shipping Temp
Blue IceStorage Temp
-20°CThis gene encodes a member of the C-lectin family, proteins that possess collagen-like sequences and carbohydrate recognition domains. This protein is a scavenger receptor, a cell surface glycoprotein that can bind to carbohydrate antigens on microorganisms facilitating their recognition and removal. In addition, these receptors can recognize oxidized phospholipids so they may also participate in removing oxidatively damaged or apoptotic cells.||Applications:|Suitable for use in Western Blot and ELISA. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|AISTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKLQASGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTNLQQDTSVLQGNLQNQMYSHN||Storage and Stability:|Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.||Note: Applications are based on unconjugated antibody.